KEGG   Desulfococcus oleovorans: Dole_1392Help
Entry
Dole_1392         CDS       T00610                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00010  Glycolysis / Gluconeogenesis
dol00020  Citrate cycle (TCA cycle)
dol00620  Pyruvate metabolism
dol00633  Nitrotoluene degradation
dol00640  Propanoate metabolism
dol00650  Butanoate metabolism
dol00680  Methane metabolism
dol01100  Metabolic pathways
dol01120  Microbial metabolism in diverse environments
dol01130  Biosynthesis of antibiotics
dol01200  Carbon metabolism
Module
dol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_1392
   00020 Citrate cycle (TCA cycle)
    Dole_1392
   00620 Pyruvate metabolism
    Dole_1392
   00640 Propanoate metabolism
    Dole_1392
   00650 Butanoate metabolism
    Dole_1392
  Energy metabolism
   00680 Methane metabolism
    Dole_1392
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dole_1392
Enzymes [BR:dol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dole_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_N Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABW67196
UniProt: A8ZYU1
Position
complement(1654315..1655505)
Genome map
AA seq 396 aa AA seqDB search
MHIIDSGNTAAATGVKLARVQVIAAYPITPQTPLTEKLSEFVESGEMKAEYIPVESEHSA
LAVCIAASSTGARAFTATSANGLLYMHEQVHWAAGARLPLVMCVANRGVGAPWSIWNDHQ
DTMSQRDTGWIHLHAANHQQIIDTVIQAFRIAETVRVPVMVCYDGYLLSHTHMPFDVPDP
DQADAFLAGSSPSALLNPARPMNLNTVTLPDVRPDVRGDMAPSYMEIRHDLHQDMRRAIT
VVEETDKAYLDRFGRGGHPLFEGYRCDDADYVALCMGSLSLQMRKVVDLLRDENIRAGVM
GLRLFRPFPAEQLAQALGNLKGIAVFEKAISYGYEGPLASELKAALYNAPTRPKVGNFVL
GLGGRTIKTEDLHTAFKDFCQTPKADAQPTWIDIKM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcattgattccggcaacaccgccgccgccacaggcgtcaaactggcccgggta
caggtcatcgccgcctatcccatcaccccccagaccccgctgacggaaaagctctccgag
ttcgtggagtccggcgagatgaaggccgagtacattcccgtggaaagcgaacacagcgcc
ctggccgtgtgcattgccgcctccagcaccggggcccgggcctttaccgccaccagcgcc
aacggcctgctctacatgcacgagcaggttcactgggccgccggcgcccggctgcccctg
gtcatgtgcgtggccaaccggggcgtgggcgcgccctggtccatctggaacgaccaccag
gacaccatgtcccagcgggacaccggctggatccacctgcacgcggccaaccaccagcag
atcatcgacaccgtgatccaggccttccgcattgccgaaaccgtgcgcgtcccggtgatg
gtctgttacgacggctacctgctctcccacacccacatgccgttcgacgtgcccgatccg
gaccaggcagacgcctttctggccggaagctcgccctcggccctgctgaacccggccagg
cccatgaacctgaacaccgtcaccctgcccgacgtgcggcccgacgtgcgcggcgatatg
gccccttcctacatggagatccgccacgacctgcaccaggacatgcgccgggccatcacc
gtggtggaagagacggacaaggcctacctggaccggttcggccgggggggccatcccctt
tttgaaggctaccggtgcgacgatgccgattacgtggccctgtgcatgggttcgctttcc
cttcagatgcgcaaagtggtggacctgctgcgcgatgaaaacattcgcgccggcgtcatg
ggcctgcggcttttccggccctttcccgccgaacagctggcacaggccctgggcaacctc
aaaggcattgccgtgtttgaaaaggcgatcagctacgggtatgaaggcccgctggccagt
gaactcaaagcagccttgtacaacgcgcccacccggccgaaggtgggcaactttgtcctg
ggcctgggcggcagaaccattaaaaccgaagacctgcacacggccttcaaggacttctgc
cagacacccaaagccgacgcgcagcccacatggatagatattaaaatgtaa

DBGET integrated database retrieval system