KEGG   Desulfococcus oleovorans: Dole_1778Help
Entry
Dole_1778         CDS       T00610                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00071  Fatty acid degradation
dol00280  Valine, leucine and isoleucine degradation
dol00310  Lysine degradation
dol00362  Benzoate degradation
dol00380  Tryptophan metabolism
dol00620  Pyruvate metabolism
dol00630  Glyoxylate and dicarboxylate metabolism
dol00640  Propanoate metabolism
dol00650  Butanoate metabolism
dol00900  Terpenoid backbone biosynthesis
dol01100  Metabolic pathways
dol01110  Biosynthesis of secondary metabolites
dol01120  Microbial metabolism in diverse environments
dol01130  Biosynthesis of antibiotics
dol01200  Carbon metabolism
dol01212  Fatty acid metabolism
dol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dole_1778
   00630 Glyoxylate and dicarboxylate metabolism
    Dole_1778
   00640 Propanoate metabolism
    Dole_1778
   00650 Butanoate metabolism
    Dole_1778
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dole_1778
   00072 Synthesis and degradation of ketone bodies
    Dole_1778
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dole_1778
   00310 Lysine degradation
    Dole_1778
   00380 Tryptophan metabolism
    Dole_1778
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dole_1778
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dole_1778
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dole_1778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dol04147]
    Dole_1778
Enzymes [BR:dol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dole_1778
Exosome [BR:dol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dole_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABW67582
UniProt: A9A0V7
Position
2143638..2144855
Genome map
AA seq 405 aa AA seqDB search
MAGHKKRKDMCMRDVVIVSGARTAIGDFAGSLSTLGPVDLGVVALNGALEKAKIDKSLVQ
EVVCGQCNQAGAPGNTARHIAMGAGLPATSFAFTVHQQCASSMRGTELVAQEIMLGKIDI
GAVVGVESMSNAPYLLFGARRGYRLSDGETVQDSLMIGGLVDALLGYHMGVTAENIAEKY
KISRQEQDEWALMSHQRAVAAIQKGWFAEEIVPVTIKTKKGDTIFDTDEHPRADTTLERL
AALRPAFKKEGTVTAGNASGLNDAGAALVLMAATTAKEMGLAPLARVVASAPGSVSPEIM
GMGVVPAVHNALNFAGMKLEQIDYFEFNEAFAAQVIGCNRELKVDPERLNGVGSGISLGH
PVGATGARLVVTMINELRRRGKKFGCAALCASGGPAHALIVEIPD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacataaaaaacgaaaggacatgtgcatgagagacgtggtaattgtcagcggc
gcgcgcaccgccattggagactttgccggttcgctttccaccctcggcccggtggacctg
ggcgtggtggccttaaacggcgcccttgaaaaggcgaaaatagacaaatcgcttgttcag
gaggtggtctgcggccagtgcaaccaggccggagcaccgggcaacacggcccgccacatc
gccatgggcgcgggcctgcccgccacctcctttgcctttaccgttcaccagcagtgcgcc
tcttccatgcggggtaccgaactggtggcccaggagatcatgctgggcaagatcgacatc
ggcgcggtggttggggtggaaagcatgagcaacgccccctacctgctgttcggggcccgc
aggggataccgcctgagcgacggggagacggtccaggacagcctgatgatcggcggcctg
gtggatgccctgctgggctaccacatgggggtgaccgccgaaaacatcgctgaaaaatac
aaaatctcccgccaggagcaggatgaatgggctttgatgagccaccagcgggccgttgcc
gccattcaaaaaggatggtttgccgaagagatcgtgccggtcaccattaaaacaaaaaaa
ggtgacaccatctttgacaccgatgaacacccccgggccgacaccaccctggagcggctg
gcggccctgcggcccgcctttaaaaaagagggcaccgtcacggcgggcaacgcctcgggc
ttgaacgacgccggcgccgccctggtcctgatggccgccaccaccgcaaaggagatgggc
cttgccccccttgcccgggtggtggcatcggcccccggctccgtctctccggagatcatg
ggcatgggcgtggtgccggccgttcacaatgcgttaaattttgccggcatgaaacttgag
cagatcgactattttgagttcaacgaggcctttgccgcccaggtcatcgggtgcaaccgg
gagctgaaggtggatccggaaaggctcaacggcgtgggctccggcatcagcctgggccat
cccgtgggcgccaccggggcccgcctggttgttacaatgatcaacgaactcaggcggcgc
gggaaaaaattcggctgcgcggccctgtgcgccagtggtggcccggcccacgcccttatc
gtggagataccggactga

DBGET integrated database retrieval system