KEGG   Desulfococcus oleovorans: Dole_2746Help
Entry
Dole_2746         CDS       T00610                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00260  Glycine, serine and threonine metabolism
dol00750  Vitamin B6 metabolism
dol01100  Metabolic pathways
dol01110  Biosynthesis of secondary metabolites
dol01120  Microbial metabolism in diverse environments
dol01230  Biosynthesis of amino acids
Module
dol_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dole_2746
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dole_2746
Enzymes [BR:dol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dole_2746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-C2H2_7
Motif
Other DBs
NCBI-ProteinID: ABW68549
UniProt: A8ZXS2
Position
3314110..3315615
Genome map
AA seq 501 aa AA seqDB search
MNPSDFPCDVQPHLVPRPGGDMVYKCLGCDATHDINTLLYTCPSCNSVLLIEDRDFDRHR
AIPGPLWRKIFDFRKSLNIPALKGVYRFHEFIGPDLPLEAVVWLGEGGTPVVEASPLLQQ
KVGIRLFFKNDGQNPSASFKDRGMASAFSRINFLLQSGILSNVLAVCASTGDTSASAALY
AAYLKPRVTSAVLLPHGKVTPQQLSQPLGNGAAVFEIAGVFDDCMKVVEELSENYNVALL
NSKNAWRILGQESYSYEIAQDFSYDTRNLTVVVPIGNAGNITAVMNGFLKFFRIGIINAL
PKIIGVQSDHASPVFQYYREPDPARRRFAPVTVKPSVAQAAMIGNPVSMPRVIRLADRYD
QAAGQRRVFVVEVSEQQIMDWQLTANRHGNIVCTHGGESLAGLVTARQQGLVTDDDMAVL
DSTAHMLKFSNFQQMYFENAFPAHYGVTPDPALVNAPQLVEVPGIATPADRETLSGPEMT
TFVRKTADEIANRLGLKRTKQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttccgactttccatgcgatgtacagccccacctggtgccccggcccgggggc
gacatggtgtataaatgccttgggtgcgacgccacccacgacatcaacacccttctatac
acctgcccttcctgcaacagcgtgctgctgatcgaggaccgggactttgaccggcacagg
gccatccccggccccctgtggcgaaagattttcgattttcgaaaaagcctcaacatcccc
gctttaaaaggggtctaccggtttcacgagtttatcggcccggacctgcccctggaagcg
gtggtatggctgggtgaaggcggtaccccggtggttgaagccagcccgctccttcagcag
aaggtgggaatccgcctctttttcaaaaacgacggccagaatcccagcgcctctttcaag
gaccggggcatggccagcgccttttcccgtattaattttcttttgcaaagcggcatcctc
tccaacgtgctggctgtgtgcgcctccacaggggacacgtcggcatcggcggccctctat
gccgcctatctcaagccccgggtcacatccgccgttcttcttcctcacggcaaggtcaca
ccccagcagctttcccagcccctgggcaacggggccgccgtgtttgaaattgccggcgtg
tttgacgactgcatgaaggtggtcgaagaattgtccgaaaactacaacgtggccctgctc
aactccaaaaatgcctggcgcattctgggtcaggagtcctactcttatgaaatcgcccag
gatttttcctacgacacccggaatctgaccgttgtggtgcccatcggcaatgccggcaac
atcacggcggtgatgaacggcttcttaaaatttttccgaatcggcattatcaatgccctg
cccaaaatcatcggggtccagtccgaccacgccagcccggtgttccagtactacagagag
cccgacccggcccggcgccggtttgccccggtgacggtcaaacccagcgtggcacaggcc
gccatgatcggcaacccggtctccatgccgcgggtgatccgtctggccgaccggtatgac
caggccgccggccaacggcgggtgttcgtggtggaagtatctgagcagcagatcatggac
tggcagctgacggccaaccggcacggcaacatcgtctgcacccatggcggcgaaagcctg
gccggcctggtaacggcacggcagcagggcctggtaaccgacgacgacatggcggtcctg
gactccacggcccacatgctcaagttctccaattttcaacagatgtactttgaaaacgct
tttccggcccattacggggtgacgccggacccggcccttgtcaatgccccgcagctggtt
gaggttcccggcattgccacgccggcggaccgggagacactgagcgggccggagatgaca
acatttgtcagaaaaaccgctgatgagattgcaaaccggcttggcttgaaaaggacaaaa
caatga

DBGET integrated database retrieval system