KEGG   Marivivens sp. JLT3646: BSK21_01710Help
Entry
BSK21_01710       CDS       T04589                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
don  Marivivens sp. JLT3646
Pathway
don00430  Taurine and hypotaurine metabolism
don00620  Pyruvate metabolism
don00640  Propanoate metabolism
don00680  Methane metabolism
don01100  Metabolic pathways
don01120  Microbial metabolism in diverse environments
don01200  Carbon metabolism
Module
don_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:don00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSK21_01710
   00640 Propanoate metabolism
    BSK21_01710
  09102 Energy metabolism
   00680 Methane metabolism
    BSK21_01710
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSK21_01710
Enzymes [BR:don01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BSK21_01710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: APO85867
Position
complement(333088..334251)
Genome map
AA seq 387 aa AA seqDB search
MTTVLTLNAGSSSLKFAVYSSDSDHPMVTGLVDRIGANATLKLKDQRGFDLPTKTDGLST
HQEALNTVLSAIEPELDGKTIDVVGHRVVHGGQWYDAPVQVTDEVIERLTTLEPFAPLHQ
PHNLSGIKAAKAAFPNAPQIACFDTAFHRHHPYVNDTFAIPRAYYDKGVRRYGFHGLSYD
YISGELRRIAPTIAHGRVVVAHLGNGASMCAIQDGKSVASTMGFSALDGLPMGTRCGQLD
AGVVLYLMDQEGLSATDISDMLYKKSGLLGLSDLSNDMRALEASDSIEARQAIDYFVFRI
QRELGGMAAAMGGVDALVFCGGIGENSAFIRDRVCERTAWMGIEIDHNKNDDHAQVISTE
MSRTTVMVIPTNEELVIARAAREFTGV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgttctaacgctgaacgcggggtcttcatcgctgaaatttgcggtctactct
tcagatagcgatcaccccatggtcacggggctggtagaccggatcggggcgaatgcaacg
ttgaaactaaaggatcaacgggggttcgacctaccaacgaagactgacggtctgagcacg
catcaagaagcgctcaacactgtgctttcggcaatcgagccagaactggatggaaagacc
attgatgtggtagggcatcgcgtcgttcatggtgggcagtggtacgacgcgccagtgcag
gtcacggatgaggtgatcgagcggttgaccacgctcgaaccgtttgcgccccttcaccaa
ccgcacaacctaagtggcatcaaggcagccaaagccgcgttccctaacgcgcctcagatc
gcctgtttcgacacagcgtttcatcgtcaccacccctatgtaaacgataccttcgcgata
ccacgcgcctattacgacaaaggcgtgaggcggtatgggtttcatgggctgtcatatgat
tacatttctggcgagttgcgccgcatcgcgccgacaatcgcccacggtcgtgtggtcgtc
gcccaccttgggaacggtgcatcaatgtgcgcgattcaagacggcaagtcagtcgcatcg
accatggggttttcggcgctcgatgggttaccgatgggaaccagatgcgggcaactcgac
gcgggtgtcgttctctatctgatggaccaagagggtctttcggccaccgacatttcagac
atgctctacaagaaatctggccttctcggcctgtctgatttgtcaaacgacatgagggcg
ttagaggcctcggatagcatcgaggcccgtcaggcgatcgactattttgtcttccgcatt
cagcgcgaactaggcggcatggcggccgcaatgggcggggttgatgcgttagtgttctgt
ggcgggattggtgaaaattcagcctttatccgtgatcgcgtctgcgagcgaactgcatgg
atgggcattgaaatcgaccacaataagaacgacgaccacgcacaggtcatctcgaccgag
atgtcccgcacaactgtcatggttatcccaacaaacgaagaactcgtgatcgcccgcgcc
gctcgcgaattcacaggcgtttaa

DBGET integrated database retrieval system