KEGG   Donghicola sp. JLT3646: BSK21_02145Help
Entry
BSK21_02145       CDS       T04589                                 

Definition
(GenBank) oxidoreductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
don  Donghicola sp. JLT3646
Pathway
don00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:don00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BSK21_02145
Enzymes [BR:don01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BSK21_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: APO85942
Position
420365..421171
Genome map
AA seq 268 aa AA seqDB search
MSFSIEGKTAIVTGAANGVGLAIGRHFIEQGANVMFADMDEAALQREIGVEIEADSGPAR
IFAGDLRKKLTIKNLLSATVDAFEQIDILVNAARQIVLTDPLNPDDDSVSMLLEQNMLSG
LRLSQAVARRMVKLAEGQDKQQVGTIINLSSIAARRTHPDLLAYSVSTAAADQMTRSLAV
ALAPHRIRVNSVAFGSVMSASLKGALKEHDGYREDILCHTPLNRIASASEVCDAVQYLAC
EASGFVTGQIITVDGGRTLIDPVGCAAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttccatcgaaggtaaaaccgcgattgtgacgggcgccgcgaatggcgtgggt
ttggcaatcggacggcatttcatcgaacagggcgcgaatgtgatgttcgctgacatggac
gaagccgcgcttcagcgcgagatcggggtggagattgaggccgacagcgggcctgcccgt
atctttgcgggtgatcttcgcaagaaactgacgatcaagaacctgctctctgcgaccgtg
gatgcatttgaacagatcgatatccttgtgaacgcggcccgtcagatcgtcctgacggat
ccgctgaaccctgatgatgacagtgtatcgatgttgctagagcagaacatgctctcgggt
ctacggttgtcgcaggcggtagcgcgtcggatggtgaaactggctgaggggcaggacaaa
cagcaagttggtacaatcatcaacttgtcgtcgattgctgcgcgacgcacccatcctgat
cttctcgcctattcggtgtcgacggctgcggctgatcaaatgacacggtcgctggccgtt
gcgctggccccgcatcgtatccgcgttaactctgtcgccttcggcagcgttatgagcgcg
agccttaagggtgcattgaaagaacacgatggataccgcgaagatatcctgtgtcacacg
ccgctgaaccgcatcgcaagcgcctctgaggtctgcgatgccgttcaatatctcgcgtgc
gaggcgtctggctttgtcacgggtcagatcatcaccgtggacggtgggcgcaccctgatc
gatcccgttggatgcgccgcgcactaa

DBGET integrated database retrieval system