KEGG   Donghicola sp. JLT3646: BSK21_05865Help
Entry
BSK21_05865       CDS       T04589                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
don  Donghicola sp. JLT3646
Pathway
don00071  Fatty acid degradation
don00072  Synthesis and degradation of ketone bodies
don00280  Valine, leucine and isoleucine degradation
don00310  Lysine degradation
don00362  Benzoate degradation
don00380  Tryptophan metabolism
don00620  Pyruvate metabolism
don00630  Glyoxylate and dicarboxylate metabolism
don00640  Propanoate metabolism
don00650  Butanoate metabolism
don00900  Terpenoid backbone biosynthesis
don01100  Metabolic pathways
don01110  Biosynthesis of secondary metabolites
don01120  Microbial metabolism in diverse environments
don01130  Biosynthesis of antibiotics
don01200  Carbon metabolism
don01212  Fatty acid metabolism
don02020  Two-component system
Brite
KEGG Orthology (KO) [BR:don00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSK21_05865
   00630 Glyoxylate and dicarboxylate metabolism
    BSK21_05865
   00640 Propanoate metabolism
    BSK21_05865
   00650 Butanoate metabolism
    BSK21_05865
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSK21_05865
   00072 Synthesis and degradation of ketone bodies
    BSK21_05865
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSK21_05865
   00310 Lysine degradation
    BSK21_05865
   00380 Tryptophan metabolism
    BSK21_05865
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSK21_05865
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSK21_05865
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSK21_05865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:don04147]
    BSK21_05865
Enzymes [BR:don01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSK21_05865
Exosome [BR:don04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSK21_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APO86602
Position
1169484..1170644
Genome map
AA seq 386 aa AA seqDB search
MEARIVGWGHTRFGVQDGVSLEALIQQAAAEAMATAGVAPGDIDAIWLGHFNNGMVPDAF
AASLVLGLDEALRFTPATRVENACASGSAAVYAARNAIRAGDARCVLVVGVEKMTELDTL
GVTAALAGASYAIEEAGVSFPQIFGRVAAGYFQAFGDQSETLARIAVKNHTNALNNPLAH
MQREVSFDFCNEVSSKNPMIAAPLRLTDCSLISDGAAALVMVADEMTADFDRAVGFRAAV
QMNDFLPMSRRDMTELTAARRTFDAAYRVAGITIDDLDLAEVHDCFTIAELMIYEAMGLA
EKGKGARLVAEGATARGGRLPVNLSGGLKAKGHPVGATGVSMHVLAAQQVAGQAGGVQLN
GAELACVFNMGGSGVANYCSILEAVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgagaatagttggctggggtcatactcggttcggggttcaagacggcgtcagc
cttgaggcgctgatccagcaggcggcggcagaggccatggcaaccgctggcgtggcgcca
ggcgatatcgacgcgatttggttggggcacttcaacaacggcatggtgcctgacgccttt
gccgcttcgttggtgctggggctggacgaggccctgcgctttaccccagcgacgcgcgtg
gaaaacgcctgcgcttcaggctctgcggctgtctatgcggcgcgcaatgccatccgtgcc
ggagatgcgcggtgcgtgcttgtggtgggggtcgagaagatgaccgaactggacaccctg
ggggtgaccgcggcgcttgcgggcgcgtcttatgccattgaggaggcgggggtcagcttt
ccgcagatcttcgggcgcgtcgccgccgggtatttccaggcttttggcgaccagtccgaa
accttggcgcgaattgcggtgaaaaaccatacaaacgccctgaacaatccgctggcacat
atgcagcgtgaggtgtcgttcgacttctgcaacgaggtcagcagcaagaacccgatgatc
gctgcgccgctgcgcctgaccgattgctcactgatctcagacggtgcggcggcgctggtt
atggttgccgatgaaatgaccgccgatttcgaccgcgccgtgggctttcgtgccgccgtg
cagatgaatgacttcctgcctatgtcgcgccgcgacatgaccgaactgaccgccgcgcgc
cgcacctttgatgccgcctatagggttgccgggatcacgatcgatgatctcgatctggcc
gaggtgcatgactgcttcacgatcgcagaactgatgatctacgaggcgatggggctggcg
gagaagggcaagggcgcgcgcctggtcgcagaaggagctaccgcgcggggcgggaggttg
ccggtcaacctttcagggggactgaaagctaagggccatccggtcggcgccacgggcgtg
tcgatgcatgttttggcagcgcagcaggttgccggacaggccgggggcgtccagctaaat
ggggcagagctggcctgcgtcttcaacatgggcggatccggtgtcgccaattactgttcc
attttggaggccgtgcgatga

DBGET integrated database retrieval system