KEGG   Marivivens sp. JLT3646: BSK21_07550Help
Entry
BSK21_07550       CDS       T04589                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
don  Marivivens sp. JLT3646
Pathway
don00471  D-Glutamine and D-glutamate metabolism
don01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:don00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSK21_07550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:don01011]
    BSK21_07550
Enzymes [BR:don01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BSK21_07550
Peptidoglycan biosynthesis and degradation proteins [BR:don01011]
 Precursor biosynthesis
  Racemase
   BSK21_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race TP_methylase
Motif
Other DBs
NCBI-ProteinID: APO86895
Position
complement(1519672..1520484)
Genome map
AA seq 270 aa AA seqDB search
MAVGVFDSGLGGLTVLDACQKRLPDVPFVYFGDNAHAPYGVRDADDIYDLTTKAVARMWD
EGCDLVIIACNTASAAALRRMQESWVPRDKRVLGVFVPLIEALTERQWGDNSPPREVEVK
HVALFATPATVRSRAFQRELAFRAIGVDVEAQACGGVVDAIEDGDMILAEALVRSHVEAL
QRKMPEPDAAILGCTHYPIMEKEFQDALGPNVKVFSQANLVAASLEDYLKRRPEMLGAGT
DTVYLTTGNPSKVSDRATQFLRRKVEFISA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcggggtttttgatagtggtttgggtgggttaacggttctggacgcatgccag
aagcgcctgcctgacgttccctttgtttatttcggggataacgcccatgcgccttatggt
gtgcgggatgccgatgacatctatgatctgaccaccaaagccgtcgcccgtatgtgggac
gaaggctgcgaccttgtgattatcgcctgtaatacggcctctgcggcggctctgcgtcgg
atgcaggaatcatgggtgccgcgtgacaaacgcgtgctcggtgttttcgtaccgttgatc
gaagcgctgaccgaacggcagtggggcgataactcgccaccgcgcgaggtcgaggttaaa
cacgttgcgctctttgcgacccctgccaccgtgcggagccgtgcgttccagcgggaactg
gcgtttcgtgcgatcggcgtggacgttgaggcgcaagcctgcggcggcgtggtggatgcg
attgaggacggggatatgatcctcgccgaagctctcgttcggagccatgttgaggcgctg
cagcgcaagatgcccgaacctgatgcggcgatccttggctgtacgcattacccgatcatg
gaaaaagaattccaagacgcgctgggtccgaacgtgaaagtgttttctcaggcgaacctc
gttgcggcgagccttgaggactacctgaagcgtcggcctgaaatgctgggggcagggacg
gacactgtctatctgaccacgggcaatccgtcgaaggtttctgatcgcgcgacacagttc
ttgcgacgaaaggtcgaattcatttcggcctaa

DBGET integrated database retrieval system