KEGG   Marivivens sp. JLT3646: BSK21_13315Help
Entry
BSK21_13315       CDS       T04589                                 

Definition
(GenBank) glycosyl transferase
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
don  Marivivens sp. JLT3646
Brite
KEGG Orthology (KO) [BR:don00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:don01003]
    BSK21_13315
Enzymes [BR:don01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     BSK21_13315
Glycosyltransferases [BR:don01003]
 Others
  Glycosylglycerate
   BSK21_13315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: APO87909
Position
complement(2665858..2667078)
Genome map
AA seq 406 aa AA seqDB search
MADFHQSGSIATLHNLRTASTEAMTNELSTFGMNRKINLILPSLFSELEGEALPAIINEL
NKVPYLNKIVIGLDRATEAEYRYARQFFSRLKVNHDILWNDGPRLQAIDERLKKLDLSPN
EPGKGRNVWFCIGYTLAQAEAAVVAVHDCDVVTYSADMLARLVYPVANPAFPYQMSKGFY
PRVADRKLNGRVSRLLVTPLLQSLKKVLGQRDYLDFLSSFRYPLAGEFAMRTAILPDMRI
PSDWGLEIGLLSEAWRNLSPQAVCQVEISDRYDHKHQDLSLDDANKGLSRMSVDICKALY
RKLAADGTVLSEEVFRSIKATYYRMALDLIDTYYNDARMNGLDLDRHAEETAVELFAANI
MQAGSVFLDNPMETPFIPNWSRVNAADPAILTDMLKAVAGDNAEFG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttggccgattttcaccaaagcggaagcatcgcgaccctgcacaatttgcggactgcatcc
accgaagcgatgacgaatgagttgtctacttttgggatgaaccgcaaaatcaacctcatc
cttccatcgttgttttcagaacttgaaggcgaggccttgcccgccatcatcaacgaactg
aataaggtgccgtacctcaacaaaatcgtcatcggtctagatcgtgcaaccgaagcggaa
taccgatatgcgcggcagttcttttctcgtctcaaggtgaaccacgacattctttggaat
gatggcccgcgtttgcaggcgattgatgaacgtttgaaaaagctggacttgtcgccaaac
gaaccgggcaaaggacggaatgtttggttctgtattgggtacacattggcccaagcggag
gctgcagtcgttgccgtgcatgactgtgatgtcgtgacctattcggcggatatgttggcg
cggcttgtgtatcccgtcgccaaccctgcattcccctatcaaatgtccaaaggtttttat
cctcgcgtagcggatcgcaagctcaatgggcgggttagtcgtttgctggttacgccgctt
ctgcagtcgctaaagaaggtcttggggcagcgagattacctcgatttcctatcgtcgttt
cgatacccgctcgcaggggagttcgcgatgcgtacggcgattttgccggatatgcgcatt
ccgtcagactgggggttagaaattggcctcttgtccgaggcttggcggaacctatcgccg
caggccgtttgtcaggtcgagatcagcgatcgctatgatcacaaacatcaggatctttcc
cttgatgatgcgaacaaggggctcagccggatgtcggtcgacatttgcaaagccctgtat
cgcaagcttgctgccgatggcacggtgctgagcgaagaggtctttcgttcgatcaaagcg
acctattaccgaatggccctcgacctcatcgatacctactacaacgacgcgagaatgaac
ggtcttgatcttgatcggcacgccgaagagactgcggttgagctgttcgctgcgaatatc
atgcaggcaggaagcgtgttcctcgataacccgatggaaacgccgttcatcccgaactgg
agccgcgtaaacgctgccgatcctgcgatcctgactgatatgctaaaggccgtagcaggc
gacaacgcagaatttggttag

DBGET integrated database retrieval system