KEGG   Marivivens sp. JLT3646: BSK21_13665Help
Entry
BSK21_13665       CDS       T04589                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
don  Marivivens sp. JLT3646
Pathway
don02020  Two-component system
Brite
KEGG Orthology (KO) [BR:don00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSK21_13665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:don02022]
    BSK21_13665
Two-component system [BR:don02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BSK21_13665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: APO87969
Position
complement(2727061..2727762)
Genome map
AA seq 233 aa AA seqDB search
MSADDAHILIVDDDERIRGLLQKFLMRNGFLVSTARDAAHARRILSGLEFDLIVLDVMMP
GEDGMSLCRDLRARLGTPIMLLTAKGETSDRIAGLEAGADDYLAKPFEPKELLLRINAIL
RRVPQAAPAVVVPKSLNMGPFRYDVDRGELWKGDDLIRLTATESQLMKIFSAKPSEPVSR
GTLVEELSRSGGQTQERAVDVQITRLRRKIEVDPKQPRYLQTVRGSGYMLQPD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgatgacgcccatattctaattgttgatgacgatgaacggatcagaggactt
ctgcaaaagttcctgatgcggaatggctttttggtgagcacggcgcgcgatgcggctcat
gcgcgtcgtatcttgtctggtcttgaattcgatttgatcgttctggacgtcatgatgcct
ggtgaggacggtatgtcgttgtgccgcgatctgagggcacgattgggcacgcccattatg
ctgctgactgcaaaaggcgagacatccgaccggattgctggtttggaagcgggcgctgac
gattaccttgcgaagccgtttgaacccaaggaactgctcttgcggatcaacgcgatctta
cgtcgtgttccgcaagcggctccggctgtcgtggtgccgaagtctctcaatatgggtccg
tttcgctacgatgtggatcggggagagttgtggaagggtgatgatctgatccgcctgacc
gcgaccgagagccagttgatgaagattttcagcgccaagcccagtgagcccgtatcgcgg
ggcaccttggtcgaggagcttagccgatctggtgggcaaacgcaggaacgcgctgtcgat
gttcagatcacccgtctgcgccgcaagatcgaagtcgatccgaagcagcctcgctatctc
cagacggttcgcggttcgggttacatgttgcagcctgattga

DBGET integrated database retrieval system