KEGG   Desulfosporosinus orientis: Desor_0283Help
Entry
Desor_0283        CDS       T01675                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00220  Arginine biosynthesis
dor00330  Arginine and proline metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01130  Biosynthesis of antibiotics
dor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Desor_0283
   00330 Arginine and proline metabolism
    Desor_0283
Enzymes [BR:dor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Desor_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF87
Motif
Other DBs
NCBI-ProteinID: AET65999
UniProt: G7WA03
Position
256577..257479
Genome map
AA seq 300 aa AA seqDB search
MQKNVIRIIGVPIDLGADRRGVDMGPSAIRYAGLNVRLKRLGWKVEDSGNLEVPVPESRE
IRDKRLKYLDEIVTINERLHIVVSEAIKEGVIPLILGGDHSLAIGTLSGLALSGKTLGVI
WFDTHGDYNSLDTTESGNIHGMPLAVANGIGASELTSIGGMKKKLQEENTVIIGAREMDP
QEKEMLRQSKITVFTMRDIDQKGMMEVVKEGIEIASRGTDGIHVSFDLDVIDPEEAPGVG
TPVPGGITYREAHLAMELLADSGRIASMDVVEVNPILDNHNKTAKLAVGLISSAFGERIF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaacgtgattagaattattggggtacctattgacttaggagcagatcgacga
ggtgtcgatatgggtccgagtgctattcgttatgcaggcttgaatgtacgtttaaagcgc
ctaggttggaaagttgaggattcaggtaatctagaggttcctgttccagagtcacgagag
ataagagataaacgtcttaaatatttagatgaaattgttacgattaatgagcgtcttcat
attgttgtttcagaagcaatcaaggaaggggttatcccattaattcttggaggggatcat
agcttggcaataggtactctatcagggttggccttgagtggaaaaactttaggagtaatt
tggtttgatactcatggagattacaattctttggataccactgaaagcggcaatattcat
ggtatgcctttggctgtagctaacgggattggggcctcggaattaacgtccattggggga
atgaagaaaaagctgcaggaagaaaacacggtgatcataggagcacgagagatggatcct
caagagaaagaaatgctgcgccaatctaaaattacggtttttacaatgcgtgatatcgat
caaaaaggaatgatggaagttgtaaaagaaggcattgagattgcctcaagaggaacggat
ggaatccatgtgagttttgatttagatgtcattgatcctgaggaggcccccggggtggga
actcctgtaccagggggaataacctatcgtgaggctcatctggccatggaactcttagca
gattcgggaaggattgcaagtatggatgtggttgaagtgaatccaattttagataaccac
aataagacggcaaaattagcagttgggctcatttcatcagcatttggagaacgaattttt
taa

DBGET integrated database retrieval system