KEGG   Desulfosporosinus orientis: Desor_0612Help
Entry
Desor_0612        CDS       T01675                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00360  Phenylalanine metabolism
dor00362  Benzoate degradation
dor00620  Pyruvate metabolism
dor00621  Dioxin degradation
dor00622  Xylene degradation
dor00650  Butanoate metabolism
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
dor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desor_0612
   00650 Butanoate metabolism
    Desor_0612
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Desor_0612
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desor_0612
   00622 Xylene degradation
    Desor_0612
   00621 Dioxin degradation
    Desor_0612
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desor_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh CagZ NAD_binding_3 GFO_IDH_MocA F420_oxidored CoA_binding HERV-K_REC Spore_GerAC
Motif
Other DBs
NCBI-ProteinID: AET66308
UniProt: G7WCI6
Position
609613..610482
Genome map
AA seq 289 aa AA seqDB search
MEKIKVGIIGPGNIGSDLMYKVIKSKHLQMHLMAGIVESEGIKRAAGLGFKTSLEGVDAV
AADPDIKIVFDATSAKAHLYNAPILKAAGKIVMDMTPAAVGPYVVPCVNLDNLAHVDNFN
MVTCGGQATIPIAHAINRVADSEYTEIVAALSSKSAGPGTRANIDEFTQTTKKALEIVGG
ADKAKAIIVLNPAEPPIMMTNTIYSIVKNPDEKKIIESVNEIVKQVQAYVPGYKLRVPPV
IDGNKVTVIVQVQGAGDFLPMYSGNLDIINQAAVAVAEKVAENLLNKEG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaattaaggtaggcatcatcggaccggggaatatcggctctgacctaatgtat
aaggtcattaaaagtaaacatctgcaaatgcacttaatggccggtatcgtggaatctgag
ggaattaaaagggcagccggactggggtttaagacttcgctggaaggtgttgacgctgtg
gccgcagatcccgatatcaagattgtctttgacgcgacaagtgcaaaagcgcatttatat
aatgcaccaatattgaaagcggcgggcaaaatcgttatggatatgactcctgctgcagta
ggcccctacgtggttccctgtgtcaatcttgacaatctggctcatgtggataactttaac
atggtaacctgcggcggacaggccacgattcccattgcccatgcgattaatcgggtggca
gattcagagtataccgagattgtggcggccctttcctctaagagcgcaggtccgggaacc
cgtgccaacattgacgaattcactcagacgaccaaaaaggcccttgaaatcgttggtggt
gcagacaaagcaaaagcaatcattgttctgaaccctgctgaaccgcccattatgatgacc
aataccatttattctatagtcaagaatccggatgagaaaaaaatcattgaatccgttaat
gagattgtcaaacaggttcaagcttatgtgcccggttacaagcttcgtgttccccctgtc
atagatggaaacaaagttaccgtaattgttcaggtacagggtgccggcgactttttaccc
atgtattccgggaaccttgatatcatcaatcaggcagcggtcgccgttgccgaaaaagta
gccgagaatctgttgaacaaggaggggtaa

DBGET integrated database retrieval system