KEGG   Desulfosporosinus orientis: Desor_0732Help
Entry
Desor_0732        CDS       T01675                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00010  Glycolysis / Gluconeogenesis
dor00030  Pentose phosphate pathway
dor00051  Fructose and mannose metabolism
dor00052  Galactose metabolism
dor00680  Methane metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_0732
   00030 Pentose phosphate pathway
    Desor_0732
   00051 Fructose and mannose metabolism
    Desor_0732
   00052 Galactose metabolism
    Desor_0732
  Energy metabolism
   00680 Methane metabolism
    Desor_0732
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desor_0732
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Desor_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DUF3859
Motif
Other DBs
NCBI-ProteinID: AET66420
UniProt: G7W7Z4
Position
738218..739297
Genome map
AA seq 359 aa AA seqDB search
MRKLAVLTGGGDCPGLNAVIRAIVKSAHGYGVEVLGIRDGFRGAVEEDFIPLSLKDVSGI
LPRGGTILGTTNRDNPFAYPTKPNGVIQPLDRSEDVLENLKNNQVDALLAIGGDGSLNIA
LKFANKGLKVIGIPKTIDNDLMSTDQTFGFQTAVDTAQEALDRLHTTAESHHRVMILEVM
GRYAGWIALYAGVAGGADVILIPEIPYNLNRVALSVQNRAKQGKKFSIIVAAEGAKPLGG
EMVVERMMKGRIDPVKLGGIGAKIARDLEEHYGLETRVTVLGHLQRGGSPNAYDRVLSTR
YGTAAVDAALEGEFGVMVALQGKEIVRVPLQEAVDHIKLVPLNNPLLVAARTLGMEFGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaacttgcggtacttacgggcggaggggattgtcccggtcttaatgcggtgatc
agggcaatcgttaaaagcgcccatggatatggtgttgaagtattgggaatcagagatgga
tttcgcggagctgttgaggaggactttatccctctttcacttaaggacgtttccggaatt
ttaccgcgagggggtactattttaggaacaactaatcgcgacaacccctttgcttatccc
accaaaccgaacggagttattcagcctttggatcgttccgaagatgtgctggagaactta
aagaacaaccaggtcgatgccctattagcaattggcggggacggcagtctgaacattgcc
ctgaagtttgccaataaagggcttaaagtgattggaattcccaagacaattgacaatgat
ttgatgtcaacggatcaaactttcggttttcaaacagcagtggatacggctcaggaagct
ttagaccgcttgcataccacggcagaatctcatcaccgggttatgattcttgaagtcatg
ggccgttatgcgggctggattgccttgtatgccggagttgctgggggagctgatgtcata
cttattccggaaataccctacaaccttaacagggtggctctaagtgttcaaaacagggct
aagcaagggaaaaaattcagcattattgtagcagctgaaggggctaagcccttggggggc
gaaatggtcgttgaacgcatgatgaaagggcggattgatcctgtaaaattaggcgggatc
ggcgctaaaatcgcccgggatcttgaagaacactatggcctggaaacccgggtaaccgta
ctgggacatctgcagaggggaggttcccctaacgcttatgaccgggtgctgtcaacacgc
tacggcacggcagcggtggatgccgctctggaaggagaatttggcgtgatggttgccctt
cagggtaaggagattgtgcgcgttcctcttcaggaagccgttgaccatattaagcttgtg
cctttaaacaatcctttgttggttgcagctcggaccttgggtatggagtttggtgattaa

DBGET integrated database retrieval system