KEGG   Desulfosporosinus orientis: Desor_0922Help
Entry
Desor_0922        CDS       T01675                                 

Definition
(GenBank) Holliday junction DNA helicase, RuvA subunit
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dor  Desulfosporosinus orientis
Pathway
dor03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desor_0922
Enzymes [BR:dor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Desor_0922
DNA repair and recombination proteins [BR:dor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Desor_0922
    RecFOR pathway proteins
     Desor_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH 5_3_exonuc HHH_2 Transposase_20 DNA_pol_lambd_f UBA IMS_HHH HHH_3 HHH_8 HHH_4 Cdd1
Motif
Other DBs
NCBI-ProteinID: AET66598
UniProt: G7WCR0
Position
942072..942671
Genome map
AA seq 199 aa AA seqDB search
MIGMLRGKVWEIQGERLVMDVQGTGYLLTVPYGLISKVHPGQDLVLYTHVVMREDDLSLY
GFSTFEEKQLFLQMLSVSGIGPKAAIALLSTFGAVQIESAIASENLNLLTKVPGIGKKTA
QRLILELKEKFRGHSLVSNEGGSFSETASQTHSEALETLLALGFGLEEGRQALSRAIKDS
GELTTEEQVKKALRFLASS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcatgctgcggggaaaagtgtgggaaatccaaggcgagcgtttggtgatggat
gtacaaggcactggctacttgctgactgtgccctatggacttatatcgaaagttcatccc
ggccaggaccttgttctatacacacatgtggtcatgcgggaagatgatttgtctctttac
ggtttttcgacatttgaggagaagcaactttttctgcaaatgttaagtgtttccggcatc
ggtcctaaagctgccatagccctgctttccacctttggcgccgtacagattgaaagtgct
attgccagtgaaaatcttaatttattgacaaaagttcccggaatcggtaaaaagaccgct
cagcggctcattcttgaacttaaagagaaatttagagggcatagtttggtatctaatgaa
ggcggttcgttttctgaaacagcgtctcagactcactcggaagccctggaaaccttgctg
gctttgggctttggcttggaagaagggcggcaggctttgagcagggccataaaagacagc
ggggaattaacgacagaggaacaagtaaagaaggcgctgcgttttctcgcctcaagctag

DBGET integrated database retrieval system