KEGG   Desulfosporosinus orientis: Desor_1358
Entry
Desor_1358        CDS       T01675                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00230  Purine metabolism
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desor_1358
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Desor_1358
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AET67019
UniProt: G7W5T1
Position
1400807..1403167
AA seq 786 aa
MAYTVVGKSVRRVDAIAKVTGKAKYTDDFSERNMLVGKILHSPYAHAIVKSIDVSKAKAL
PGVEAVLTYKDLPDIRYATALPGVIEAIATDDVDVAELKYGTAGHPFSLDESHRDKEDRR
ILTQKARFVGDNIAAVVATDALIAAKALKLIEVEYELLEPLTSPEAALKEGAPLIHDDSE
RNILSSNGYEIGNFEEAVKEADRVFEGEYETSIVQHCHMENQVSHAYVDSDRRIVIMSST
QIPHIVRRIVAQSLGISWGRVRVIKPYVGGGFGNKQDVCIEPLNAAMTLAVGGRPVRLEL
SREEAMIDTRTRHAFKFKIKTGINNDGKMVAIHISAISNTGAYASHGHSIAGSAGGKFRY
LYPTKALKYDPITVYTNLPVAGAMRGYGTPQIFFAFESHIEDIAKKLNMDPVELRKKNLV
EVGYVDPASKNKIMSCGIRECIEKGKELINWDVKKSLYKEQSGDKRRGLGMACFSYASGT
YPVALELAGARIVMNQDGSVQLQLGATEIGQGSDTVFAQMVSEILGIPMYMVHVISTQDT
DITPFDTGSYASRQTYVSGMAVEKAALEVKKKVLEVAHKLTDLPAHVLDLRDQYVVMKES
GEQVIALEIVAMQSFYDRVNAQPITSDVSNNARINAIPFGVTFAEVEVDIKTGKIKIIEI
YNVHDSGKIVNPLLAEGQVHGGVSMGIGYALSEQLLFDEATGKPLNNNLLDYKLPTIMDT
PDIGAAFVEKEDPTGPFGVKSLGEPPIVSPAPAIRNAVLDATNVAFNRIPMNPQRVFEKF
KETGLI
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcttatacagttgttggaaaaagcgttagaagagtcgatgctatagctaaagtaaca
ggcaaggccaaatatacagatgatttttctgaacgtaacatgttagttggtaaaattttg
catagtccatatgcccatgcaattgtcaaatctattgatgtaagcaaggcaaaagcttta
ccgggagtagaagctgtactgacctacaaagatttgccggatatccgttatgccacggct
ctgccgggagtcatcgaagcaattgccacggatgatgtcgatgttgcggagttgaaatac
ggaacagcgggccatcccttttctctggatgaaagtcatcgggacaaagaagatcgtcgc
atattaacccaaaaggcgcgctttgtcggagataatattgcagcggtggtggcgacggat
gctctgattgctgcaaaagctcttaaattaattgaagttgaatatgaattgttagaaccc
ttgacaagtcctgaggctgccctaaaagaaggtgcacccttaattcatgatgatagtgaa
cgcaatattttgtcttccaatggatatgaaatagggaatttcgaagaagctgtcaaagaa
gctgatcgggtatttgaaggggagtacgaaacaagtatcgtacagcattgccacatggag
aatcaagtttctcatgcctatgtggattccgatcgtagaatagtgattatgagttccact
cagatcccccatattgttcgcaggattgttgctcaatctttagggatttcctggggaagg
gtacgtgtcatcaagccttatgttggaggtgggtttggtaacaagcaggatgtttgtatt
gagcctttgaatgcggctatgacgttagccgtgggcggacgccctgtaagattggagctt
tctcgggaagaagctatgattgacacccgaactcgacatgcttttaagtttaaaattaag
acaggaattaataatgacggcaaaatggttgccattcatatttcggctatttccaataca
ggggcctatgcttcccatggacattccatcgcaggcagtgcgggaggtaaattccgctac
ctttatccaaccaaagcattgaaatatgatcctatcactgtctacaccaatttgcctgtt
gcaggagcaatgcggggatatgggacaccgcagatcttttttgcttttgaatcacatatt
gaagacatagctaaaaagctaaatatggaccctgttgaacttcgcaagaaaaacctcgtt
gaggttggttatgtagacccggctagtaaaaataaaattatgagctgcggcattcgggaa
tgtatcgaaaaaggtaaagaacttattaattgggatgttaagaagtctctgtacaaggaa
cagagcggagacaagcgccggggtttaggtatggcttgtttcagctatgcctcgggaacc
tatcccgtagccttggagcttgccggagcgcggattgttatgaaccaagacggctcagtg
cagctgcagcttggtgccacagaaattggccagggcagtgatacggtctttgcccagatg
gtgtctgagattctgggcattcctatgtacatggttcatgtaatatccactcaagatacg
gacattactccttttgataccggatcctatgcttcgcggcaaacctatgtctccggaatg
gcggttgaaaaagctgccttagaagttaaaaagaaagttctggaagttgctcataaattg
acagatttacctgcccatgtattagatcttcgggatcagtacgttgtcatgaaagagtcc
ggagaacaagtaattgccctggagattgttgccatgcagtctttctacgatagggtcaac
gctcagccaataaccagtgatgtatctaataatgcacgaatcaatgctattccctttgga
gttacttttgcggaagtggaagtggatattaaaaccggaaaaatcaagattatcgagatt
tacaacgtccatgattccggtaaaattgttaacccgcttttagcggaagggcaagtccac
ggcggagttagcatgggaattggctatgccttgtcggaacagttgctgtttgatgaggcg
acaggtaaacctcttaacaataatttattggattataaacttccgacaatcatggatact
cccgatattggtgctgcttttgtggaaaaagaagatccgacgggaccctttggtgtgaag
tctcttggcgagcctcccattgtttctcctgctccggcgattcgtaatgcagtattagac
gccacgaatgtagcctttaatcggataccgatgaatccgcagcgggtttttgaaaagttt
aaagaaacgggattaatctag

DBGET integrated database retrieval system