KEGG   Desulfosporosinus orientis: Desor_1360
Entry
Desor_1360        CDS       T01675                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
dor  Desulfosporosinus orientis
Pathway
dor00230  Purine metabolism
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desor_1360
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AET67021
UniProt: G7W5T3
Position
1404056..1404562
AA seq 168 aa
MYKRIAFTVNGKAYDFEVDVRESLLEVLRERLGLTGAKQGCGVGECGACSVLIDGVPHDS
CIYLAVWADGKVIRTIEGVAANNGELSDVQKAFVEEGAVQCGFCTPGLVLTTTALKEGGK
DYNREELKRELSGHLCRCTGYQGILKAAEKSLEGHVCTCVDSPHYKGK
NT seq 507 nt   +upstreamnt  +downstreamnt
ttgtataaacgaatagcctttacagtgaatggaaaagcctatgattttgaggtggatgtt
cgagagtctctgttggaggttttaagagaacgcctgggtttgacgggtgctaaacaaggg
tgtggagttggcgagtgcggtgcttgcagcgtgcttattgacggagttcctcacgactcg
tgtatctatttggcggtttgggcagatgggaaggtgattagaaccattgagggagttgct
gccaataacggggaactttccgatgttcaaaaagcttttgtagaagaaggggcggtacag
tgtggtttctgtaccccgggtttagttctgacgaccactgccttgaaggagggtggcaaa
gactacaaccgtgaagaattaaaacgtgaactctctgggcacctgtgtcgttgtaccgga
tatcaaggcatcttaaaagctgcggagaaatccttggaagggcatgtttgtacttgtgtt
gatagtcctcattataaaggaaagtaa

DBGET integrated database retrieval system