KEGG   Desulfosporosinus orientis: Desor_2028Help
Entry
Desor_2028        CDS       T01675                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00260  Glycine, serine and threonine metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desor_2028
Enzymes [BR:dor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Desor_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AET67637
UniProt: G7WF26
Position
2142982..2144013
Genome map
AA seq 343 aa AA seqDB search
MYSFKDDYSEGAHPRILNALIETNLKQVTGYGEDEYSLEAIQLIKRKMNSPQVHVHLMCG
GTQTNLTVISAFLRPHEAAVAANSGHILVHETGAIEGTGHKVLACEVKDGKLTPEDIHAV
LEAHTDEHMVKPKLVYISNPTEIGSIYIKSELEALSRFCQENKLFLYVDGARLGSALCSD
ENDLELSDLPRLVDAFYIGGTKNGALLGEALVICRDSLNEDFRYHIKQKGGLLAKGRVLG
LQFLELFKDNLYFELAKHANEMAGLLKTELERAGFGFFTHSPSNQIFPILPDKLIAKLRE
NYEFYTWAKMDDTHSAIRLVTSWATEKEAVLGFCQDLQNYCKD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttttaaagatgattacagcgaaggagctcatcccagaatcctcaatgcctta
atagaaaccaatctcaagcaggtaacgggatatggggaagatgagtacagcctggaagca
attcagttaataaaaagaaaaatgaacagtccccaggtgcatgttcacctgatgtgtggg
ggtacacaaaccaatttgacggttatatcagccttcttgagacctcatgaagcggctgtg
gcagcaaattctggacatattttagtccatgaaaccggcgctattgaagggaccgggcat
aaagtgcttgcttgtgaagtaaaggacggcaaactgacacccgaggatatccatgccgtg
ctcgaagctcataccgacgagcatatggttaagcccaaactggtctatatctccaatccc
acggaaattggttcaatctatatcaagtcggagcttgaggctttgagtaggttttgtcaa
gaaaacaagcttttcttgtacgtggacggggcacggctggggtcagccctttgctctgac
gagaatgatctggaattaagtgacctgccccgtctggtggatgccttctatatcggcggc
acgaaaaatggggcattgctgggagaagcactggtgatttgccgggattcgcttaatgaa
gatttccgctatcatattaagcaaaaagggggcttgctggccaaaggaagggttctcggc
ctgcagtttctggaactctttaaagataatttatactttgagctggctaaacatgccaac
gaaatggcagggttgctgaagacggaattggaaagagccggatttggtttcttcacccat
tcaccctcaaatcagatatttcccattttgccggacaagcttatcgccaagctccgggaa
aactacgaattttatacctgggcaaaaatggacgatactcattcggccattcgccttgtg
acctcctgggctactgaaaaagaggctgtcctgggcttttgccaagatttgcaaaactac
tgtaaggattag

DBGET integrated database retrieval system