KEGG   Desulfosporosinus orientis: Desor_2275Help
Entry
Desor_2275        CDS       T01675                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00500  Starch and sucrose metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desor_2275
Enzymes [BR:dor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desor_2275
Exosome [BR:dor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desor_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase CCM2_C
Motif
Other DBs
NCBI-ProteinID: AET67872
UniProt: G7WB91
Position
2373705..2375627
Genome map
AA seq 640 aa AA seqDB search
MSKYHWLTLEEVYLFNRGELYHSYLRMGAHRIGGHGIQGTHFAVWVPDALKVFLVGEWNH
WRSDRDFMLEEIGSSGIWTLFVPENLEGQLYKYEIHTKKGQVFLKADPFAFCSELRPATA
SRVWTLAGFSWQDQEWLERRKTTDIRKAPLLIYEVHPGSWRKRADGSYYQWPDLGRELIS
YVVQMGYTHIELMPIMEHPFDGSWGYQATGYYACTSRFGSPQGFMAFVNQCHRAGIGVIL
DWVPGHFCKDAHGLGRFNGDFLYERDENQQWGTYNFNFEKTEVWSFLISNAVFWLEEFHV
DGLRVDGVSNMLYAGHERANRKSQANRDGGRENREAVSFMKKLNEVIHRYFPDVLMIAEE
STDWPHVTSGREEEGPGCQRGLGYDFKWNMGWMNDTLRYVSSDFSQRSEFHNLLTFSMTY
AYSEQFILPLSHDEVVHGKKSLINRLPGDYGQKFAGLRCLYGYWLSHPGKKLLFMGGELA
QFIEWNEERPLDWFLLDYEMHRRLQEYVCDLNHLYRKEKAFWQNDQDWSGFAWIDVHNWQ
QSILVFSRRGSQPQDELVILCNFQPQSYENFRIGVPRPGVYEELLNSDQEKYGGENYLNQ
GLLRAENKPWHGQKNSLVIHVPSLAIVILKPILNTKVLEE
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtatcactggctaacccttgaagaagtttacctttttaaccgtggagaatta
taccacagctatttaaggatgggggctcatagaataggaggtcacggaattcagggtacc
cattttgcggtttgggtcccggatgctcttaaggtttttctggtgggggaatggaatcac
tggcgttcagacagggatttcatgcttgaagagatagggagcagcgggatatggaccctt
tttgtacctgaaaatttagaagggcaattatataaatacgaaatccataccaagaagggg
caagtgttcctgaaagcagacccctttgccttttgttcggaattaaggccggccacagct
tcaagggtttggaccctggcgggtttttcctggcaggatcaggagtggctggagagacga
aaaacaacggacatcaggaaagctcctcttttaatctatgaggttcatcctggctcatgg
cgaaaaagagcggacgggagctattatcaatggccggatttggggagagagctcatcagc
tatgtagtgcaaatggggtatacccatattgaattaatgcccattatggagcaccctttc
gatggttcctgggggtaccaggcaacggggtattatgcctgtaccagccgcttcggcagt
cctcagggatttatggcttttgtcaatcagtgtcatcgagccggcattggcgtaatttta
gactgggtgccggggcatttttgcaaagacgctcatggactggggagattcaacggtgac
tttctctatgaaagggatgaaaaccaacagtggggcacttataactttaacttcgagaaa
accgaggtttggagctttctcatctctaatgccgtcttctggttggaagaattccacgtg
gacgggctgcgggtggacggagtaagcaatatgctttatgccggtcatgaacgagctaat
cgcaagtcccaggccaatagggatggaggcagagaaaatcgcgaagccgtatcctttatg
aagaaattaaatgaagtaatccaccggtattttcccgatgttctgatgattgccgaggaa
tctacggattggccccatgtaacatccggccgggaggaggaaggcccggggtgtcaaagg
gggctgggctatgatttcaagtggaacatgggctggatgaacgataccctgcgctatgtc
agctcggatttttcccagcggagcgagtttcataacctgctgaccttttccatgacctat
gcttactcggagcagtttatcctgcctttgtctcatgacgaggtggttcatggcaaaaag
tccttaattaatcgcctgccgggggactatgggcaaaaatttgccggtttaaggtgcctc
tacggctattggctgagccatcccggcaagaaactcctctttatgggtggtgagctggct
cagttcatcgagtggaatgaagagcgccccctggattggttcttgctggactatgaaatg
caccgtcggctgcaagaatatgtgtgtgatctgaaccacctgtatcgaaaggaaaaggcc
ttttggcaaaatgatcaggactggtcgggctttgcctggattgacgtccataattggcag
caaagtattctggttttctcccgccggggcagtcagccccaggatgaactggttatcctc
tgtaattttcagccgcaaagctatgagaatttccgcattggggtaccccgcccaggggtg
tacgaagaactactgaactctgatcaggaaaaatacggcggggagaattatctcaaccag
ggtttgctcagggcggaaaacaaaccctggcatggccaaaaaaattccctggttattcat
gttccttcattagcaatagttatattaaagccgattttgaatactaaagtattggaggaa
taa

DBGET integrated database retrieval system