KEGG   Desulfosporosinus orientis: Desor_3539Help
Entry
Desor_3539        CDS       T01675                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00330  Arginine and proline metabolism
dor00332  Carbapenem biosynthesis
dor01100  Metabolic pathways
dor01130  Biosynthesis of antibiotics
dor01230  Biosynthesis of amino acids
Module
dor_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desor_3539
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desor_3539
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desor_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA FLgD_tudor
Motif
Other DBs
NCBI-ProteinID: AET69022
UniProt: G7WH08
Position
complement(3652094..3653215)
Genome map
AA seq 373 aa AA seqDB search
MTLNGVRRIVLKIGSSSLNHPQGGLDEAAIAQVVSAIADLKKHGVECIIVTSGAVAAGMG
RLKLHNRPRDLPGKQAVSAVGQGVLIEMYTRNFEQHGIVGAQVLLSRIDLAQASHYRNAQ
NTLEKLLRLHVVPIINENDTVAVDELCFGDNDTLSALVAGLVGVDLLVILTDVDGLYTAN
PKKDQSAQLIKEVAEVSAVECMASGAGSMLGTGGMVTKLRAARIATHFGIGTLLLNFTRL
KELDDLTKGEAPEGTYFKPVKHRLAGRKRWIAYAGLSEGCIHVDDGAAKALLEEGKSLLA
KGITGVSGTWERKEIVRILNSRGEEIAKGVVELNHDEVLQVKGMHSGKLHELIENFEGEE
VVHRDNMTVMVDM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgaatggggttcggagaattgtcctgaaaataggaagcagtagtttgaaccat
ccccagggaggcttagatgaagccgctattgctcaagtcgtttcagcaattgcggactta
aaaaagcatggcgtggaatgtattattgttacttccggtgccgtagcggctgggatggga
cgtctaaaacttcataaccggccgagagatttgccgggcaagcaagcggtatcagccgtt
ggacagggtgtgctgatcgagatgtataccaggaatttcgaacagcatggtattgtagga
gcccaggttttgttgtctcgaatcgacttagctcaagcatcccattacagaaacgctcaa
aatacactggaaaaattacttcgcttgcatgtagtaccaattatcaatgaaaacgacaca
gttgctgtagatgagttgtgctttggcgataatgataccttgtcggctttggtagccggg
ctggtaggcgttgatttgctggtcattttgacagatgtggacggcttatatacggctaac
cctaaaaaagatcaatcagctcagctcattaaagaagttgcagaggtttcagcagtagaa
tgtatggccagtggggccggaagtatgttgggaaccggaggaatggtcactaaactgagg
gcggcgagaattgcaacacactttggcattggtactcttcttttgaatttcacacgcttg
aaggaattggacgatcttaccaagggtgaggccccggagggcacttactttaagccggta
aagcaccgcctggcaggaaggaaacgttggattgcctatgccggattgtctgaaggctgt
atccacgtcgatgatggagctgccaaagcccttttggaagaaggaaaaagcttgctggca
aaaggaataacaggtgtctccggaacttgggaacggaaggaaattgtgagaatactcaat
agtcgaggagaggagatcgcgaaaggagtcgttgagctaaatcacgacgaggtactccag
gtcaaagggatgcactccgggaagctccatgaactcattgaaaattttgaaggggaggaa
gtggtccatcgagataatatgacagtgatggtggatatgtaa

DBGET integrated database retrieval system