KEGG   Desulfosporosinus orientis: Desor_3603Help
Entry
Desor_3603        CDS       T01675                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00040  Pentose and glucuronate interconversions
dor00052  Galactose metabolism
dor00500  Starch and sucrose metabolism
dor00520  Amino sugar and nucleotide sugar metabolism
dor01100  Metabolic pathways
dor01130  Biosynthesis of antibiotics
Module
dor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desor_3603
   00052 Galactose metabolism
    Desor_3603
   00500 Starch and sucrose metabolism
    Desor_3603
   00520 Amino sugar and nucleotide sugar metabolism
    Desor_3603
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desor_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AET69083
UniProt: G7WIK9
Position
complement(3707841..3708743)
Genome map
AA seq 300 aa AA seqDB search
MKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVASGIESILIVTGRNK
KSIEDHFDKSVELEQTLWEKGKSDILHEIQNISDMANIHFIRQKEPLGLGNAILCAEQFV
GEEPFAVLLGDDIMVADPPGLKQLIEVFETYQTTVVGVQRVQPEEVSKYGIISGVKEQPR
ILSVKDMIEKPAPANAPSNIAIMGRYILMPSIFSFLKTQERGAGNEYQLTDALKEICLKD
HLLALELDGERYDIGDKFGYIKAIIEMGLQREELQPQLVKYLQHALKNQGFKHKLKRAAG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagaaaagcggtcattcctgcggcaggcttaggaacccggtttttgccggcg
acaaaagctcagcccaaagaaatgctgcctatcgttgataagccggcaattcagtatatt
gttgaagaagccgtggcttcaggaatcgaaagtattctcatcgtcacaggcagaaataaa
aaatcgatagaagatcattttgacaagtctgtggaacttgagcagacactttgggaaaaa
ggaaaatcggatattctccatgagatccaaaacattagtgatatggcaaatatccatttt
atacgccaaaaagaaccccttggcttaggcaatgctattctttgtgcagaacaatttgtt
ggggaagaaccctttgcagtcctgttaggggatgacatcatggtagcggacccaccggga
ttaaagcagttaatcgaagttttcgagacctatcagacaacggttgttggtgtgcaaagg
gttcaaccggaggaagtcagcaagtatggaattatttcgggtgttaaagagcaaccaagg
attttgagcgtgaaggatatgatcgaaaaacctgctccggccaatgccccttcgaatatc
gccatcatgggcaggtatatcttgatgccgtcgattttttcctttctgaaaacgcaagag
cgaggagcgggcaatgaataccagctcactgatgccctgaaggaaatttgtcttaaggat
catcttttagccttggagctggatggagagcgctatgatatcggggataagtttggctat
ataaaagcgattatcgaaatgggcctccagcgggaagaactgcagcctcaattagtaaag
tatttacagcatgctttaaaaaatcaaggtttcaaacataagctgaaaagagcggcagga
tga

DBGET integrated database retrieval system