KEGG   Desulfosporosinus orientis: Desor_3913Help
Entry
Desor_3913        CDS       T01675                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00071  Fatty acid degradation
dor00280  Valine, leucine and isoleucine degradation
dor00310  Lysine degradation
dor00362  Benzoate degradation
dor00380  Tryptophan metabolism
dor00620  Pyruvate metabolism
dor00630  Glyoxylate and dicarboxylate metabolism
dor00640  Propanoate metabolism
dor00650  Butanoate metabolism
dor00900  Terpenoid backbone biosynthesis
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
dor01212  Fatty acid metabolism
dor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desor_3913
   00630 Glyoxylate and dicarboxylate metabolism
    Desor_3913
   00640 Propanoate metabolism
    Desor_3913
   00650 Butanoate metabolism
    Desor_3913
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desor_3913
   00072 Synthesis and degradation of ketone bodies
    Desor_3913
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desor_3913
   00310 Lysine degradation
    Desor_3913
   00380 Tryptophan metabolism
    Desor_3913
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desor_3913
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desor_3913
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desor_3913
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dor04147]
    Desor_3913
Enzymes [BR:dor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desor_3913
Exosome [BR:dor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desor_3913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C HTH_7
Motif
Other DBs
NCBI-ProteinID: AET69358
UniProt: G7WBW1
Position
complement(4015480..4016658)
Genome map
AA seq 392 aa AA seqDB search
MRDVVIVSAVRTPVGSFCGALGQIPAAELGAIAVKEAINRAGITPEQVDEVILGNVLQAG
LGQNPARQASIKAGIPQEVPSWTLNKVCGSGLKTVVCAAQAIMTGDADIVVAGGMENMSL
APYVLTKARTGYRMGNDTVIDSMINDGLTDAFNNYHMGITAENIAEQFNISREEQDRYSV
RSQNRAEAAIIAGKFNEEIVPVSIPQRKGDPVVVSQDEFPRFGATYEAIAKLRPAFKKDG
TVTAANASGINDGAAAIVVMAKEKAEELGLTPLATIKSWASAGVDPKIMGTGPIPASRKA
LEKAGLSIDDIDVVEANEAFASQTLSVAQGLNLDPEKTNVNGGAIALGHPVGASGTRILV
TLLHEMKRSNAHRGLATLCIGGGQGVALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagggacgttgttattgtaagcgcagtgcgtactcccgtcggctctttttgcggtgca
ttaggccaaattccagccgcagagcttggtgccattgctgtcaaagaagcgattaataga
gcggggattactcctgagcaagtcgatgaagttattttaggtaacgtgttacaggctgga
ctaggacaaaatccggctcggcaggcgtctatcaaagctggaattcctcaggaagtgcct
tcctggacactaaacaaagtttgcggatcgggactcaaaaccgtagtgtgtgcagctcag
gctattatgacaggagatgctgatattgttgtagcaggcggtatggagaatatgtctctt
gctccttatgtacttacaaaggcgcgcacgggctatcgcatgggcaatgataccgtgatt
gattccatgattaatgatgggctgacggatgcctttaacaattatcacatgggaatcaca
gcggaaaatattgccgaacagtttaatatttcccgtgaggagcaagaccgttactcagta
agaagtcagaaccgtgctgaagctgcgattattgccggcaagtttaatgaagaaatcgtt
ccggtatctattccacaacgcaaaggagatcctgttgtggtttctcaagatgagtttcct
cgttttggagcaacttacgaagcgattgccaaacttcgcccggcctttaaaaaggatgga
acagttacagctgccaatgcatcgggtatcaatgacggagctgccgccatcgtagtcatg
gctaaagagaaggcagaggaattaggcttaactcctcttgccaccatcaaatcatgggct
tccgccggagtggatcccaagatcatgggaaccgggcctattccagccagtcgtaaagcc
ttggaaaaggctgggctgtccattgacgatatagatgttgtagaggctaacgaagccttt
gcttcacaaacattaagtgttgctcaaggtttgaatcttgatccggagaagaccaatgtt
aacggcggtgctattgctttgggtcatcctgttggagcatcaggaacacgcattctcgtg
acattgcttcatgaaatgaagcgcagcaacgcccatcgcggtttggcaactctttgcatc
ggcggaggccaaggggttgctttaatagtagaacgctaa

DBGET integrated database retrieval system