KEGG   Desulfosporosinus orientis: Desor_4314
Entry
Desor_4314        CDS       T01675                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00230  Purine metabolism
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desor_4314
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Desor_4314
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AET69744
UniProt: G7WJ85
Position
complement(4466899..4469229)
AA seq 776 aa
MKTFNVVGKNIKRNDALEKATGKAMFSTDMNIPGMLYAKVLRSPHAHALIKSIDTSIAEK
IPGVKAIATWENTPRELFNTSATMTFTVPSMEPVLDQYIFDKVVRYVGDEVAAVAAVSEK
VAAEALKHIKVEYELLPAVFDPLEAMKPEAPIIHECPAGKNIPAEIVKFGMGDIEKGFAE
SDVIFEDMFTLPIQKQAQLETQAALAQVGSDGSITVWSTTQTPHPSRMILSKIFATPQSK
IRVLNPPYVGGGFGVRIGLSAKAEPIAVALSKLTGKPVKIVYTREEDFTSSDTRHGGYVW
VKLGCKKDGTFQAMELKSALNAGAYCSFSGETPGVLGAMGLAVYRMEHMSYYGHSVYTNF
TPSGAMRGFGNPQAMFAIEAAVDTLAERIGMDPLELRLKNIIQVGDKWCLPYACGSTGLA
ECIQKAAKAIGWERRGTLNEPGSKILRGIGMGVGTHCSNAWPFCVDYDNAIITVQQDGSM
LLAVGVPDIGTGTSTTLPQLAAETIGVEMDQVNMTFADTLTTPFDIGSHASRTLYAAGTA
VVAAGNDVRKQILEYAADVMKIALERLDITKGIIHISGYNEAEACEGSGICQSGEESMTH
ISVKELVYHAHLRNKQFIGIGRTTPPNSPPWHAHFYEVEVDTETGMVKVVKVAAAHDVGK
AVNPMIVEGQIEGGVLMGVGYATSEEIKINAKGKPLHTSYHKYLLPTAMDAPEIQAIIVE
SNDPSGPYGAKGVGECGMVLSAAAIGNAVYNATGIRFNEIPLTPERVYKKLQENKK
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgaaaaccttcaatgtggttggcaaaaatatcaaaagaaatgatgccctggagaaagca
acaggaaaagccatgttttctactgacatgaatataccggggatgttatatgccaaagtt
ttgcgcagtccccacgcgcatgctctcataaaaagtattgacacatcgatagcagaaaaa
attcccggcgtcaaagcgatagcgacatgggaaaacacaccccgggagctgttcaatacg
tctgctaccatgacctttacagtgcccagtatggaaccggtcctggaccagtatattttt
gataaggtcgttcgttatgtcggtgatgaagtggccgcagtggcagccgtcagcgagaag
gtcgctgcagaagccctgaaacatattaaggtagaatatgaacttcttccagctgtattc
gatcccttggaggctatgaaaccggaagctccaattattcatgaatgtcctgccggcaaa
aatattcccgcagaaatcgttaaattcggaatgggcgatatagaaaaaggtttcgcagaa
tcggatgttatcttcgaagatatgtttacgctgccaattcaaaaacaagcccagttggaa
actcaggcagcccttgcccaggtgggttcggatggaagtatcacggtatggtccaccact
caaacacctcatccctcgcgcatgattctttcgaagatttttgcgactcctcagagcaaa
attagggttttaaatcccccttatgtaggaggcgggtttggagtccgaattgggttaagc
gcgaaagcggagcctatcgcagttgccctttctaaacttaccggaaaacccgtgaagata
gtttatacaagggaagaggacttcacttcttccgataccaggcatggcggatatgtttgg
gtaaaattaggctgcaaaaaagatgggactttccaagctatggaattgaaaagtgcctta
aatgcgggtgcatactgcagctttagcggtgaaacgccgggtgtcttgggagctatgggg
ttggcagtctatcgcatggagcatatgagttattatggtcacagcgtttacaccaacttc
acgccctcgggtgccatgcgtggctttggcaacccacaggctatgttcgctattgaagct
gccgtggataccttagccgaacggatcgggatggatccactggaactacgtctgaagaac
atcatacaagttggtgataaatggtgtcttccctatgcctgtggatctaccggtttggca
gaatgtattcaaaaagcagctaaagctattggctgggaacgaagaggaacactgaatgag
ccgggtagtaagatcctcagaggtatcgggatgggagtcggaactcattgtagtaacgct
tggccgttctgtgttgattatgataatgcgattatcactgtccagcaggatggatcgatg
ctgttggctgtaggtgtccctgatattggtacgggaacatcgacaaccctgcctcaattg
gctgctgaaaccattggagtagaaatggatcaagtcaatatgacgttcgcagacaccctg
actacaccctttgatataggaagccatgccagcaggacactgtatgctgcaggtactgct
gttgtcgccgctggtaatgatgtgcgcaaacagattttagagtatgctgcagacgtcatg
aaaattgctctggaacgattggatattaccaaggggatcattcatatatctggatacaat
gaagcagaggcttgtgaaggcagcggaatttgccagtccggtgaagagtcgatgacgcat
atttccgtaaaagaattggtctatcatgcccacttgcgcaacaagcagtttatcggaatc
ggtcggaccacaccacctaattcccctccctggcatgcccatttttacgaagtggaagtg
gatacagagaccggtatggtgaaagtggtgaaagtagcagctgcccatgatgtaggtaaa
gcggtcaaccctatgatcgtcgaagggcagattgaaggtggagtactcatgggagtaggc
tacgccacaagtgaagaaatcaagatcaatgccaaagggaaacccctccacactagttat
cataaataccttttgccaactgccatggatgctccggaaatccaggcgatcattgttgaa
tctaatgatccgtccggtccttatggggcaaaaggtgtaggcgaatgtggcatggtgctg
tcggcagctgcgataggcaatgcggtctacaatgcaacgggaattcgcttcaatgaaatc
cccctgactccagaaagagtctataagaaacttcaagaaaacaaaaaataa

DBGET integrated database retrieval system