KEGG   Draconibacterium orientale: FH5T_08995Help
Entry
FH5T_08995        CDS       T03072                                 

Definition
(GenBank) serine acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
dori  Draconibacterium orientale
Pathway
dori00520  Amino sugar and nucleotide sugar metabolism
dori01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FH5T_08995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dori01005]
    FH5T_08995
Enzymes [BR:dori01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     FH5T_08995
Lipopolysaccharide biosynthesis proteins [BR:dori01005]
 Unusual sugar
  FH5T_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF2613
Motif
Other DBs
NCBI-ProteinID: AHW59684
UniProt: X5DF71
Position
2189187..2189750
Genome map
AA seq 187 aa AA seqDB search
MSYYKHETAIIDEGAQIGSGTRIWHFSHVMASAHIGARCILGQNVFIGNQVKLGDNVKVQ
NNVSVYEGVICEDDVFLGPSVVFTNVINPRSSVQRKDEFKPTLVKKGASIGANATIVCGV
TLGEYCMIGAGAVVTKDVLPFALLTGVPARQTGWVSRSGEILGHDLTCAKTGEKYCIENG
KLILIEG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagttattataaacacgaaacagccataattgatgaaggagcacaaatcggttccggc
acaagaatatggcatttttcacatgtgatggcttctgcccacattggagcccggtgtatt
ctagggcaaaatgtttttattggcaatcaggtaaagctgggtgataatgtaaaagttcag
aataatgtttcggtgtacgaaggtgtaatttgcgaagacgatgtttttctggggccttcc
gtagtatttacgaatgttatcaatcctcggagtagcgtacagcgaaaagatgaattcaaa
ccgacgctggtaaaaaaaggggcaagcattggcgccaatgcaaccattgtttgtggcgtt
actttaggcgaatattgcatgataggagccggggcggtggtaacaaaagatgtgttgcct
tttgctttgcttactggtgtgccggcccgccaaacgggatgggtaagccggagcggggaa
attttagggcacgatttaacctgcgcgaaaacgggagaaaaatattgcatcgaaaatggg
aaactgatacttatagaaggatga

DBGET integrated database retrieval system