KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0102400-01
Entry
Os01t0102400-01   CDS       T02163                                 

Gene name
Os01g0102400
Definition
(RAP-DB) Histone-fold domain containing protein.
  KO
K08066  nuclear transcription factor Y, gamma
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os01t0102400-01 (Os01g0102400)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os01t0102400-01 (Os01g0102400)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF ANAPC9 DUF4922 CENP-X
Other DBs
RAP-DB: Os01t0102400-01
Position
chr01:140150..141415
AA seq 421 aa
MEQTLDVPRSLRLPTPKAQQQMDEFWRDRQKEIETTKDFSEHAIPMARLKKIASSQKGNM
MMSFDMPAFLSKMCELFVQELAVRAWASAQSHNRCIILDTDIAEAIASTESYDFLVDILH
NHREKHKSTPCSTLTTKRCRLVDQPSTSRPPYQHQLPLFAPTYTPAIPITPSLMPPISHY
IPFQYPSLSQEVSTMMASAPIVNRSMLLIHNIARGLGLQGNNISTFANNNIPDNIIGCSS
PAVLASMMSPALLDVAGASLNPPNSHSICTMNMINSSDPSGSSIGDINVANQASLAPSEH
FNPAILQESSCPSFLYNNNNDTIVVVPEGVDISGTMDVAGLVINGQEEEHERKTNVEQNE
IYESIDIGIINASVADGNKCSIRWDELGTADDSLLDKFLEEFQARNDGVLHSGIVLHEDH
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggagcaaactttggacgtacctagatcgttgaggctaccgacaccaaaggctcaacaa
caaatggatgaattttggagggatcgacaaaaagagattgagacaacaaaggactttagc
gagcatgcgatccctatggcccgcttgaagaagatcgcatcttctcaaaagggtaacatg
atgatgtcctttgacatgccagcattcttatcgaagatgtgtgagctcttcgtacaagaa
cttgctgtgcgtgcatgggcatctgctcaatcccataaccgttgcatcatactagacacg
gatattgctgaagccattgcctccacagagtcttatgactttcttgttgatatcctccat
aatcaccgtgagaagcacaaatccactccttgttctacacttactacaaagcgttgtagg
ttagtcgatcaaccttccacatctcgcccgccctaccaacatcagctgccactgtttgct
cctacatatactccagccatccctattactcctagtttaatgccaccaatttctcactat
ataccgttccaatatccatccttatcacaagaagtgtccacgatgatggcttccgcaccc
atagtgaatagatcaatgttgctcattcacaacatagcaaggggtctaggcttacaagga
aacaatatcagcacattcgccaacaataatatcccagacaatattattggttgtagtagc
cccgcggttcttgcaagtatgatgagtcctgctttactagacgttgcaggggcatcacta
aatccgccaaactctcactccatctgcacgatgaacatgatcaactcgagtgatcccagt
ggatctagcattggtgacattaatgttgcaaatcaagcaagtcttgctccctctgaacat
tttaaccctgctatccttcaagagtcctcatgtccttcgttcttatataataacaacaat
gacacgattgttgttgtaccggagggtgtagatattagtggcaccatggatgttgctggt
ttagttatcaatggtcaagaagaagaacatgagaggaaaacaaatgttgagcaaaatgag
atatatgaaagcattgatataggaataatcaatgcaagtgttgcggatggtaataaatgc
agtattaggtgggatgaattaggaacggccgatgattcattgctagataaatttttggag
gagtttcaagcaagaaacgacggtgttttgcacagcgggattgtgttgcatgaagaccat
tcctag

DBGET integrated database retrieval system