KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0160100-01Help
Entry
Os01t0160100-01   CDS       T02163                                 

Gene name
Os01g0160100
Definition
(RAP-DB) Similar to Pyruvate decarboxylase isozyme 2 (EC 4.1.1.1) (PDC) (Fragment).
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0160100-01 (Os01g0160100)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     Os01t0160100-01 (Os01g0160100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
RAP-DB: Os01t0160100-01
Position
chr01:complement(join(3139598..3140098,3138146..3138309,3137398..3138048,3137037..3137154,3136759..3136947,3136502..3136672))
AA seq 597 aa AA seqDB search
MDTTIGSVPTASDAAAPAPAANSAPREATLGRHLARRLAEVGARDVFTVPGDFNLTLLDE
LEAEAGAGHGGVRLVGCCNELNAAYAADGYARARGGGVGACAVTFTVGGLSAINAVAGAF
SENLPVVCIVGGPNSNDYGSNRILHHTIGLPDFTQELRCFQTVTCYQAVVNNLEDAHEQI
DAAISTAIKESKPVYISISCNLPSIPHPTFSRHPVPFFLSPRLSNQMNLEAAVETAAAFL
NKAVKPVLVGGPKMRVAKACKSFVELADACGYPVAVMPSAKGLVPEHHPRFIGTYWGAVS
TPFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVQPDRVVIGHGPAFGCVLMK
DFLHALSARLKKNTAAYENYRRIYVPPGEPPLSEPGEPLRVNVLFQHIQKMLSANSAVIA
ETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAKAAKDKRVIACIGDGSFQVT
AQEVSTMLRWGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGVVEAFHNGEGKCYTA
KVRTEEELKEAIEEAQGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacgatcggctcggtgccgacggcctccgatgcggcggcgcctgcccccgcg
gcgaactccgcgccgagggaggccacgctggggcggcacctcgcgcggcggctggcggag
gtcggggcgcgcgacgtgttcacggtgccgggggacttcaacctcacgctgctcgacgag
ctcgaggcggaggcgggggcggggcacggcggggtgcggctcgtcgggtgctgcaacgag
ctcaacgcggcgtacgccgccgacgggtacgcccgcgcgcgcggcggcggggtcggggcg
tgcgccgtcacgttcaccgtcggtggcctcagcgccatcaacgccgtcgccggcgcgttc
agcgagaacctccccgtggtgtgcatcgttgggggccccaacagcaacgactacgggagc
aaccgcatcctgcatcacaccatcgggctgcctgatttcacgcaggagctcaggtgcttc
cagactgtcacttgctatcaggcggtggtgaacaacttggaggatgcacatgagcagatt
gatgctgccatctccactgcaataaaggagagcaagcctgtttacataagcatcagctgc
aacctcccctctatcccacatcccacctttagccgccaccctgttcctttcttcctgtcc
ccaagattatcaaaccagatgaacctggaggcagcagtggaaactgctgcagctttcctg
aacaaagcagtcaagccagtcctcgttggtggaccaaaaatgagggtggccaaagcatgc
aaatccttcgtagagctggctgatgcctgtggttatcctgttgcggtcatgccttctgca
aagggtcttgtgccagagcaccatcctaggtttattggcacgtactggggtgctgtgagc
actccattttgtgctgagatcgtcgagtcagctgatgcatatctatttgctggcccaata
tttaatgactacagctcggttggatactcactacttctcaagaaggagaaggccatcatc
gtccagccagaccgggtggtgataggtcatgggcctgcgtttgggtgtgttctgatgaag
gacttcctgcatgcactttcagcacggctgaagaaaaacacggctgcatatgagaactat
cgtcggatttatgtgcctccgggtgaacctcctttgtctgagcctggagagccattgaga
gtgaatgtacttttccagcatattcagaaaatgttgtcagccaactcggctgtcattgct
gagactggagactcttggtttaattgccagaagctaaagctaccagagggctgtgggtac
gaatttcaaatgcaatatggatcaattggttggtcggtaggtgcaactctgggatatgca
aaggctgctaaggataagcgagtcattgcttgcatcggagatggaagctttcaggtgacg
gcacaagaagtgtcgacaatgcttcgttgggggcagaaaagcatcatcttcctcataaac
aatggagggtacaccatcgaggtggagatccatgacggtccttacaatgtcatcaagaat
tggaactacaccggtgtggtggaagcgttccataatggcgaggggaagtgctacacggca
aaggtccgaactgaggaggaactgaaggaagcaattgaagaagctcagggacctaagaag
gattgcttgtgcttcatagaggtgattgtacacaaggatgacacaagtaaggagcttctt
gagtggggctccagagtttctgctgcaaatagccgcccaccaaatcctcagtga

DBGET integrated database retrieval system