KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0220300-01
Entry
Os01t0220300-01   CDS       T02163                                 
Symbol
Os01g0220300
Name
(RAP-DB) Translation elongation  factor EF1B/ribosomal protein S6 domain containing protein.
  KO
K02990  small subunit ribosomal protein S6
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Os01t0220300-01 (Os01g0220300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dosa03011]
    Os01t0220300-01 (Os01g0220300)
   03029 Mitochondrial biogenesis [BR:dosa03029]
    Os01t0220300-01 (Os01g0220300)
Ribosome [BR:dosa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Os01t0220300-01 (Os01g0220300)
  Bacteria
    Os01t0220300-01 (Os01g0220300)
Mitochondrial biogenesis [BR:dosa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Os01t0220300-01 (Os01g0220300)
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
RAP-DB: Os01t0220300-01
Position
chr01:join(6583822..6584004,6586632..6586889)
AA seq 146 aa
MPLYDCMLLVKPLVTREAMAELVGRVARRAYQRNGVVTDVKSFGTICLGYGIKKLDGRHF
KGQLMQMTMMVPPSFTQELHYLNKEDRLLRWLVVKHRDAVYGVEFINEDDGRREMTDFRY
RTKDEASDVDEYDDDDDDYEYEIDEE
NT seq 441 nt   +upstreamnt  +downstreamnt
atgccgctctacgactgcatgctgctggtgaagccgctggtgaccagggaggccatggcg
gagctcgtggggcgggtggcgcggcgggcgtaccagcggaacggcgtcgtcaccgacgtc
aagtccttcggcaccatctgcctcggctacggcatcaagaagctcgacggccgccacttc
aagggccaacttatgcaaatgaccatgatggttccaccctccttcacccaagaactccac
tacctgaacaaggaggacaggctgctccgctggctggtggtgaagcacagagacgcggtg
tatggtgtggagttcatcaacgaggacgacgggaggagggagatgacggacttccgctac
cgcaccaaagacgaggccagcgatgtcgatgagtatgatgacgacgatgatgactatgaa
tatgagatcgacgaggagtaa

DBGET integrated database retrieval system