KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0267200-01
Entry
Os01t0267200-01   CDS       T02163                                 

Gene name
Os01g0267200
Definition
(RAP-DB) Similar to 26S proteasome non-ATPase regulatory subunit 14 (26S proteasome regulatory subunit rpn11).
  KO
K03030  26S proteasome regulatory subunit N11
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    Os01t0267200-01 (Os01g0267200)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dosa01002]
    Os01t0267200-01 (Os01g0267200)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dosa04121]
    Os01t0267200-01 (Os01g0267200)
   03051 Proteasome [BR:dosa03051]
    Os01t0267200-01 (Os01g0267200)
Peptidases and inhibitors [BR:dosa01002]
 Metallo peptidases
  Family M67
   Os01t0267200-01 (Os01g0267200)
Ubiquitin system [BR:dosa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    Os01t0267200-01 (Os01g0267200)
Proteasome [BR:dosa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     Os01t0267200-01 (Os01g0267200)
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF5352
Other DBs
RAP-DB: Os01t0267200-01
Position
chr01:join(9166454..9166580,9166658..9166835,9168256..9168337,9168907..9169083,9169174..9169341,9169466..9169657)
AA seq 307 aa
MERLQRIFGASGMGQPPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFV
DDYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWL
SGVDINTQQSFEALNPRAVAVVIDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVG
HLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLILKSFDTHSKTNE
QTVQEMLNLAIKYNKAVQEEDELPPEKLAIANVGRQDAKKHLEEHVSNLMSSNIVQTLGT
MLDTVVF
NT seq 924 nt   +upstreamnt  +downstreamnt
atggagcggctgcagcggatcttcggggcgtcggggatggggcagccgccgacggactcg
ccgctgctcgactcctccgagcaggtctacatctcctccctcgccctcctcaagatgctc
aagcacgggcgggccggcgtgccgatggaggtgatggggctgatgctcggggagttcgtc
gacgactacaccgtcagggtggtcgacgtcttcgccatgccgcagagcgggacgggcgtc
agcgtcgaggccgtcgaccacgtcttccagaccaacatgctcgacatgctcaagcagacc
gggagaccagaaatggtggtgggctggtatcactcccatcctggatttggatgttggctt
tcaggtgttgatatcaacactcagcagagttttgaagctttaaatcccagggctgttgca
gttgtgatagacccaatccagagtgtcaaggggaaggtggtcattgatgcatttcgtctc
attaatcctcagaccatgatgcttggccaggaaccgcgacagacaacatcaaatgttggg
catctaaacaaaccatctatccaggctcttattcacgggctgaacagacactactactcc
attgcaatcaattaccgcaaaaatgaactggaggagaaaatgttgcttaacttacacaaa
aagaaatggaccgatggattgattttgaagagttttgacactcattcgaaaaccaatgag
cagactgttcaggaaatgctgaacctagccatcaaatataacaaggcagtgcaggaggag
gatgagctgccacctgagaaactagcgattgccaatgtgggacggcaggatgccaagaag
cacttggaagagcatgtctcaaatttgatgtcgtcaaacatagttcagaccctaggaacc
atgctcgacacggttgtgttctag

DBGET integrated database retrieval system