KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0273100-01
Entry
Os01t0273100-01   CDS       T02163                                 
Symbol
Os01g0273100
Name
(RAP-DB) Similar to Ubiquitin conjugating protein-like (Ubiquitin-conjugating enzyme) (Ubiquitinating enzyme).
  KO
K06688  ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Os01t0273100-01 (Os01g0273100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dosa04121]
    Os01t0273100-01 (Os01g0273100)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     Os01t0273100-01 (Os01g0273100)
Ubiquitin system [BR:dosa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   Os01t0273100-01 (Os01g0273100)
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
RAP-DB: Os01t0273100-01
Position
chr01:9445766..9446341
AA seq 191 aa
MARGENNTGAHGSGNVPPPATAASTAAGTAAASGKQQARGAGAEGQSVVRRLQSELMALM
MGGDPGVSAFPEGDNIFSWVGTIAGSAATAYEGTSYRLSLAFPGEYPYKPPKVRFETPCF
HPNVDAHGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNNDSPLNTQAAALWPNQDEFR
KMVEKLYKPTA
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcgaggggcgagaacaacaccggcgcgcacggcagcggcaacgtgcctcctcccgcc
accgccgcgtccacggcggcggggacggcggccgcgtccgggaagcagcaggcgcggggg
gcgggggcggaggggcagtcggtggtgcggcggctgcagtcggagctgatggcgctgatg
atgggcggcgacccgggcgtgtccgcgttcccggagggggacaacatcttcagctgggtg
ggcaccatcgccgggtccgccgcgacggcgtacgagggcacctcctaccgcctctccctc
gccttccccggcgagtacccgtacaagccgcccaaggtgaggttcgaaaccccctgcttc
cacccaaacgtggacgcccacggcaacatctgcctcgacatcctccaggacaagtggtcc
tccgcctacgacgtccgcaccatcctcctctccatccagagcctcctcggcgagcccaac
aacgactcccccctcaacacccaggccgccgccctctggcctaaccaggacgagttcagg
aagatggtcgagaagctctacaagcccaccgcgtag

DBGET integrated database retrieval system