KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0276000-01
Entry
Os01t0276000-01   CDS       T02163                                 
Symbol
Os01g0276000
Name
(RAP-DB) Similar to 60S ribosomal protein L30.
  KO
K02908  large subunit ribosomal protein L30e
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Os01t0276000-01 (Os01g0276000)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dosa03011]
    Os01t0276000-01 (Os01g0276000)
Ribosome [BR:dosa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Os01t0276000-01 (Os01g0276000)
  Archaea
    Os01t0276000-01 (Os01g0276000)
SSDB
Motif
Pfam: Ribosomal_L7Ae Hydrolase_6
Other DBs
RAP-DB: Os01t0276000-01
Position
chr01:complement(join(9661169..9661189,9660919..9661024,9658946..9659047,9658509..9658577,9658382..9658419))
AA seq 111 aa
MVAAKKTKKSTDNINNKLQLVMKSGKYTLGYKTVLRTLRNSKAKLVIISNNCPPLRKSEI
EYYAMLAKVTVHHFHGNNVDLGTACGKYFRVCCLSIIDPGDSDIIKTTGEQ
NT seq 336 nt   +upstreamnt  +downstreamnt
atggtggccgcaaagaagacgaagaagtccacggacaacatcaacaacaagctgcagctc
gtgatgaagagcggcaagtacacgctcggctacaagaccgtcctcaggaccctcaggaac
tccaaggcgaagctagtgatcatttctaacaactgcccacctcttcggaagtcagaaatt
gagtactacgctatgttggccaaggtcaccgtccaccatttccacggaaataatgtcgat
ctggggacagcctgtggtaaatacttccgtgtttgctgcctcagcattattgatcctggt
gactcggatatcatcaagaccacgggtgagcagtaa

DBGET integrated database retrieval system