KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0281400-00
Entry
Os01t0281400-00   CDS       T02163                                 
Symbol
Os01g0281400
Name
(RAP-DB) Coatomer, beta subunit domain containing protein.
  KO
K17301  coatomer subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os01t0281400-00 (Os01g0281400)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dosa04147]
    Os01t0281400-00 (Os01g0281400)
Membrane trafficking [BR:dosa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    Os01t0281400-00 (Os01g0281400)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Os01t0281400-00 (Os01g0281400)
SSDB
Motif
Pfam: Adaptin_N Coatomer_b_Cpla Coatamer_beta_C HEAT_2 Cnd1 DUF5578 Arm Coatomer_g_Cpla DUF484 Alpha_adaptinC2
Other DBs
RAP-DB: Os01t0281400-00
Position
chr01:complement(join(10024938..10026989,10023576..10024085,10022770..10022855,10021861..10022065))
AA seq 950 aa
MEKPSTLLVHFDKGSAAMAGEIKADLEGSDVAAKVDAMKRAVMLLLNGETLPTLFITVVR
YVLPSEDHTIQKLLLLYLEIIDKRDAAGRGLPEMILICQNLRNNLHHPNEYIRGVTLRFL
CRLSEPEVLEPLVPSILENLDHRHHFIRRHALSAISSIYRLPHGDQLVPDAPELVERALA
SEQDASARRNAFLMLCTCAQERAVAYLLSNADRVAEWPDLLQMAAVDLIRKVCRSPNRAD
KGRYIKIIIALLSSPSTAVVYECAGALVSLSSAPTAVRAAANTYCELLSSQSDNNVKLIV
LDRLNELRTSHRDVMVDVVMDVLRALASPNLDVKRKVLDLVLDLLTARNVEEVVLYLKKE
VVKTQAGELEKSGEYRQMLVQAIHACAVEYPEVAGSVVHLLMDFLGDTNVAAAVDVVLFV
REIIETNPKLRVSMIQRLIDTFYQIRASRVCSCALWILGEYSLSLSEVENAISTIKQCLG
DVPFYTVSEEGEATDSAKPAQPVVNSVTVSSRRPVVLADGTYATQSAATEAISTPSVAPG
SLSSTLNLRSLILSGDFFLAAVISCTLTKLVLRLEEVQPSMVEVNKACTGALLVMTSILQ
LGQSSYLPHPIDNDSYDRIVLCVRLLCNTGDDVRKVWLQSCRQSFAKMLAEKQFRETEEM
KAKAQISHAQPDDLIDFYHLKSRRGMSQLELEDEVQDDLKAATGGFTKDAYDANRLNRIL
QLTGFSDPVYAEAYVTVHHYDIVLDVTIINRTKETLQNLCLELATMGDLKLVDRPQNYTL
APESSKQIRANIKVSSTETGVIFGNIVYETSNVMERSVVVLNDIHIDIMDYISPATCADV
TFRNMWAEFEWENKVAVNTVIQNEKEFLDHIIKSTNMKCLTPPSALDGECGFLAANLYAK
SVFGEDALVNISIEKQFDGKLSGYIRIRSKTQGIALSLGDKITLKQKGGS
NT seq 2853 nt   +upstreamnt  +downstreamnt
atggagaagccgagcacgctgctggtccacttcgacaagggctccgccgccatggccggt
gagatcaaggcggatctcgagggcagcgacgtggccgccaaggtggacgccatgaagcgc
gccgtcatgctcctcctcaacggcgagaccctccccaccctcttcatcaccgtcgtccgc
tacgtcctcccctccgaggaccacaccatccagaagctgctcctcctctacctcgagatc
atcgacaagcgcgacgccgccggcaggggcctcccggagatgatcctcatctgccagaac
ctccgcaacaacctccaccaccccaacgagtacatccgcggcgtcaccctccgcttcctc
tgccgcctctccgagcccgaggtgctcgagccgctcgtgccctccatcctcgagaacctc
gaccaccgccaccacttcatcaggcgccacgcgctctccgcgatctcctccatctaccgc
ctcccgcacggcgaccagctcgtccccgacgcgcccgagctcgtggagcgcgcgctcgcc
tcggagcaggacgcctccgcgcgccggaacgcgttcctcatgctctgcacctgcgcgcag
gagcgcgccgtcgcgtacctgctctccaacgccgaccgcgtcgccgagtggcccgacctc
ctgcagatggccgccgtcgatctcatccgcaaggtctgccgctccccgaaccgcgccgac
aagggaaggtatatcaagatcatcatcgcccttttgtcatcccccagcaccgctgttgtc
tatgagtgcgctggtgcgctcgtgtcgctctcctcggcgcccactgccgtgcgcgctgcc
gcaaacacgtactgcgagctgctgtcgtcacagagcgacaacaatgtgaagctcattgtc
ctggaccgcctgaatgagctgcgcacctcgcaccgtgatgtgatggtggatgtagtgatg
gacgtgctgcgtgcactcgccagtcccaacttggatgttaagaggaaggtgctggatttg
gtgctcgatctgctcaccgctcgtaatgtggaggaggttgttctgtacctcaagaaggag
gtggtcaagacgcaggcaggggaacttgagaagagtggtgaataccgccagatgctggtg
caggcgatccatgcctgtgctgtggagtatccagaggtggctgggtcagtggtgcaccta
ctcatggatttccttggtgacactaatgttgctgctgcagttgatgttgtgttgttcgtg
cgtgagatcattgagactaatcccaagctgcgtgtgtccatgatccagagattgattgat
acattctatcagatccgggcatcccgtgtgtgctcgtgtgctttgtggatccttggggag
tactctctctccttatcagaggttgagaatgctatctccaccattaagcaatgccttggc
gatgtaccgttctatacagtatctgaggaaggggaggcaactgactcagccaagccagca
caaccagtggtgaactctgttaccgtgtcttctaggcggcctgttgttcttgcagacggc
acttatgccacacagagtgctgccactgaggccatttctactccatcagttgctcctggg
tcattatcatcgaccctgaatctcagatcactcattctgtcaggcgatttcttcttggct
gccgttatttcctgtaccttgaccaaacttgtattgaggctggaggaggttcagccctca
atggttgaagtgaacaaggcttgtactggggctttgctggtcatgacatccattctgcag
ctgggacaatcatcttaccttccacacccaattgataatgattcatatgacaggatagtg
ctttgtgtgaggttgctttgcaatactggtgatgatgtcaggaaggtctggttacagtca
tgtaggcagagctttgcaaagatgcttgctgagaagcagttccgggagacagaggagatg
aaggcaaaggcacagatctctcacgctcaaccagatgatcttatagatttctaccacctg
aagagcagaaggggcatgagtcagcttgagttggaagatgaagttcaagatgacttgaag
gctgcaactggtgggtttactaaggatgcatatgatgcaaacagacttaaccgcattctt
cagttgactggattcagtgatcctgtgtatgctgaagcatatgtgacagttcatcattat
gatattgtacttgatgtgactatcattaaccgtacaaaggagacacttcagaacttgtgc
ttggaattggctacaatgggagacctcaaacttgttgaccgccctcagaactacaccttg
gctcctgagtcaagcaaacaaatccgtgctaatatcaaggtttcatcaacagagactgga
gtaatatttgggaacattgtttatgaaacttcaaatgtgatggagcgatcagtggttgtg
ctaaatgatattcacattgacatcatggattatatctcaccagcaacttgcgctgatgtt
actttccgtaacatgtgggcagaatttgagtgggaaaacaaggtggcagtgaatactgtc
attcagaatgagaaggagtttttggatcatatcatcaagtcaacaaacatgaagtgtcta
acaccaccgtctgcgcttgacggagaatgcggttttctcgccgctaacctttatgcaaag
agtgttttcggtgaagatgctttggtaaatatcagcatcgagaagcagtttgatggcaag
ctcagtggttacatcagaataaggagcaagacccagggaatcgcactcagcttaggagac
aagattaccctcaagcagaagggaggcagttaa

DBGET integrated database retrieval system