KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0282800-02
Entry
Os01t0282800-02   CDS       T02163                                 
Symbol
Os01g0282800, BETA-TUBULIN_1, TUB1
Name
(RAP-DB) Similar to Tubulin beta-5 chain (Beta-5 tubulin).
  KO
K07375  tubulin beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Os01t0282800-02 (Os01g0282800)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dosa03036]
    Os01t0282800-02 (Os01g0282800)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dosa04812]
    Os01t0282800-02 (Os01g0282800)
   04147 Exosome [BR:dosa04147]
    Os01t0282800-02 (Os01g0282800)
Chromosome and associated proteins [BR:dosa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Other tubulins
     Os01t0282800-02 (Os01g0282800)
Cytoskeleton proteins [BR:dosa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    Os01t0282800-02 (Os01g0282800)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os01t0282800-02 (Os01g0282800)
  Exosomal proteins of colorectal cancer cells
   Os01t0282800-02 (Os01g0282800)
  Exosomal proteins of bladder cancer cells
   Os01t0282800-02 (Os01g0282800)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2 Misat_Tub_SegII
Other DBs
RAP-DB: Os01t0282800-02
Position
chr01:complement(join(10101880..10102273,10100897..10101166,10099683..10100362))
AA seq 447 aa
MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRG
LSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGDYEDEEEQVPEDE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagggagatcctgcacatccagggcgggcagtgtggcaaccagatcggctccaagttc
tgggaggtggtctgcgacgagcacggcatcgaccccaccggccgctacgtcggcacctcc
gacctccagctcgagcgcgtcaacgtctactacaatgaggcctcctgcggccgcttcgtg
ccccgcgccgtgctcatggacctcgagccgggtaccatggacagcgtccgcaccggcccc
tatggccagatcttccgccccgacaacttcgtcttcggccagtccggcgccggcaacaac
tgggccaaggggcactacaccgagggcgcggagctcatcgactctgtgctcgatgtcgtc
aggaaggaggctgagaactgcgactgcctccaaggtttccaagtttgccattcccttgga
ggaggcactggatctggaatgggcacactcctgatctccaagatcagagaggagtaccct
gaccggatgatgctcacattttctgtcttcccttcaccaaaggtctcagacacagttgtt
gagccttacaatgcaactctctctgtccatcagttggtggagaatgctgatgagtgcatg
gttcttgacaatgaggcactttatgacatctgcttccgcaccctcaagctgaccactcct
agctttggcgacctgaaccacttgatcagtgctacaatgagtggagttacttgctgcctt
cgcttccctggtcaattgaactctgacctccgcaagctggccgtgaacttgatccctttc
cctcgcctgcacttcttcatggtgggctttgcgccactcacctcgcgtggctcgcagcag
tatcgcgccctcactgtccctgagctcacccagcaaatgtgggacgccaagaacatgatg
tgtgccgctgacccgcgccatggccgctacctcacggcctccgccatgttccgtggcaag
atgagcaccaaggaggtggacgagcagatgatcaacgtccagaacaagaactcgtcctac
ttcgtcgagtggatccccaacaacgtgaagtccagcgtgtgcgacatcccgccgcgcggc
ctctccatggcgtccaccttcatcggcaactccacctccatccaggagatgttccgccgc
gtgagcgagcagttcaccgccatgttcaggaggaaggccttcttgcattggtacaccggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgaccttgtctcc
gagtaccagcagtaccaggatgccaccgccgacgaggagggcgactacgaggacgaagag
gagcaggtccccgaagacgagtaa

DBGET integrated database retrieval system