KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0283300-01
Entry
Os01t0283300-01   CDS       T02163                                 
Symbol
Os01g0283300
Name
(RAP-DB) Conserved hypothetical protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Other DBs
RAP-DB: Os01t0283300-01
Position
chr01:10134304..10135125
AA seq 273 aa
MARRRHACFLLLLPLLVLQLLLAGGSLVDDLPAATHQVPRLVGPQRKLQQLPNPRPQPQP
LPQPNPNPQPQPLPQPQPQPQPQPQPLPQPQPQPQPLPLPGPQPLPQPGPQPNPNPQPLP
QPNPNPQPLPQPDPNAPPLPLPQPNPNNPQPLPQPDPNAPSLPLPQPDPNAPPLPLPQPD
PNAPPQPLPQPDPNNPQPLPQPDPNAPPQPLPQPDPNSPPQPLPQPDPNTPPGQQINAKI
SSQPDSIGGARTLYPYGVIYNLMPLFSLFFYMF
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcgaggcgtcgccatgcttgctttcttctcctgctgcctctgctggtgctgcagctt
cttcttgctgggggaagcttggttgatgatcttcctgctgcaactcatcaggtgccgagg
ttagtagggccacagcgcaagttacagcagcttccaaacccaaggccacagccgcaacca
ttgccccagccaaacccaaatccacagccacaaccactcccacagccacagccacagcca
caaccacaaccacaacctctgccacaaccgcagccgcaaccacagcctttaccgctacca
ggcccacaaccattaccgcaacccggcccgcagccgaacccaaacccccaaccgttacca
cagccaaacccaaatccccagcctttacctcagccagacccgaacgctccgccgttgcct
ctgccgcagcctaacccaaacaacccgcaacctctgccgcagccagaccctaacgcgcca
tcactacctctgccgcagccagacccaaacgcgccaccactgcctctgccacaacctgat
ccgaacgcgccaccacaacctttgccgcaaccagacccaaacaaccctcaacctttaccg
caacctgaccctaacgcaccaccacagcctttgccgcaaccagaccctaactcgccgcca
cagcctttgccgcaaccagacccgaacacgcctcctggccaacaaattaatgcaaagata
tcatcacagccggattctattggtggagccagaactttatatccatacggtgtaatatac
aatctcatgccattgtttagcctattcttctatatgttttga

DBGET integrated database retrieval system