KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0300600-01
Entry
Os01t0300600-01   CDS       T02163                                 
Symbol
Os01g0300600
Name
(RAP-DB) Similar to carbohydrate binding.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: CarboxypepD_reg EMC7_beta-sandw SdrD_B bMG3 fn3 La
Other DBs
RAP-DB: Os01t0300600-01
Position
chr01:complement(join(11029032..11029184,11028023..11028250,11027392..11027483,11026862..11027090,11026402..11026758,11026036..11026109,11025836..11025941))
AA seq 412 aa
DVDIKILAAGKSKYASLKERDIAMETKTNSEGSFFAGPLYDDIGYTVEASKAGYHLKQTG
PYTFSCQKLGQILVRIYGEQDAELLPSVLLSLSGEEGYRNNSISGSGGTFSFGNLFPGSF
YLRPLLKEYKFTPSAVAIDLNSGESREVEFRATRVAYSAMGSVTLLTGQPKEGVFVEARS
ESRGYYEEATTDSFGRFRLRGLVPGSIYSVRVVAKDDHRFAAVERASPEYVSIDVGQDDI
SGIDFVVFERPESTILSGHVEGDDLDMLQPQLSVEIRSAADPSRIESVLPVPLSYYFEVQ
NLPKGKHLVQLRSGLPSHTHRFESEIVEVDLDKQPQIHVGPLKYKTEERHHKQELTPAPV
FPLIVGVSVIALVISMPRLKDLYQSAVGMTTLGSAAAPIKKEPRKTIMRKRA
NT seq 1239 nt   +upstreamnt  +downstreamnt
gatgttgacatcaagatcctagcagcagggaagagcaagtatgcatctctgaaggaaagg
gacatagcaatggagacaaagacaaattctgagggatcattctttgcaggtcccctgtat
gatgatattggatatacggtggaagcttcaaaggctggctatcatctaaagcaaactggc
ccgtacaccttttcttgtcagaagcttggtcagatattggtacggatttatggtgaacaa
gatgccgagcttttaccttctgtattgctgtctttgagtggtgaagaaggctacagaaat
aattctattagtggttctggtggaactttcagctttggtaacttatttccaggaagtttc
tatctccgacctcttctcaaggaatataaattcactccatcagcagttgctattgatctc
aattctggtgagtctagagaggttgaattccgtgcaactcgtgttgcctacagtgccatg
ggttctgtaaccctgctgactggccaaccaaaagagggagtatttgttgaagcaagatct
gaatcaagaggttattatgaggaagctactactgattcttttggtaggtttcgccttaga
ggactcgtccctggctcaatttattctgtaagagtggttgcaaaagatgatcacaggttt
gcagcagttgagcgtgcttcacctgaatatgtgtcaattgatgttggtcaggatgacatc
tctggtattgattttgttgtttttgaaagaccggaatcaacaattttgagtggccatgtg
gaaggagatgatcttgacatgttgcaaccacaactgtctgttgaaattagatcagctgca
gacccttctagaatagaatctgtactccctgttcctctctcgtactacttcgaagtacag
aatttgccaaaaggaaagcatcttgttcagcttcgttctggtcttccatcacatacccat
agatttgagtcagagatagttgaagttgacttggacaagcaacctcagattcatgttggt
cctcttaaatataaaaccgaagagcgacatcacaaacaggaattaactccagcccctgta
tttcctcttattgtcggagtttccgtgattgcattggtcatcagcatgccaaggctaaaa
gacttgtaccaaagtgctgtgggaatgactaccctaggttctgcggctgcgccgataaaa
aaggagccaagaaagacaatcatgagaaagagggcgtga

DBGET integrated database retrieval system