KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0315800-01Help
Entry
Os01t0315800-01   CDS       T02163                                 

Gene name
Os01g0315800
Definition
(RAP-DB) UDP-glucuronic acid decarboxylase (EC 4.1.1.35).
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00520  Amino sugar and nucleotide sugar metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os01t0315800-01 (Os01g0315800)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Os01t0315800-01 (Os01g0315800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR TrkA_N
Motif
Other DBs
RAP-DB: Os01t0315800-01
Position
chr01:complement(join(11910166..11910766,11909172..11909318,11908309..11908388,11908131..11908214,11907955..11908029,11907256..11907546))
AA seq 425 aa AA seqDB search
MASELTYRGGAGAPGSASDGGEYSPKPSKPLSWLTRAARYAAAEHRPAFALAGMLLAAAL
FSLYAPSSDASSSAATTTTTTFSHLSSLPSSSAASLHESAGGKVPLGLRRRALRVLVTGG
AGFVGSHLVDRLVERGDSVIVVDNFFTGRKDNVAHHLANPRFEVIRHDVVEPILLEVDQI
YHLACPASPVHYKYNPIKTIKTNVVGTLNMLGLAKRIGAKFLLTSTSEVYGDPLQHPQVE
TYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANLEVRIARIFNTYGPRMCIDDGRVVSN
FVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMSLMEGEHIGPFNLGNPGEFTMLELAK
VVQDTIDPNARIEFRPNTADDPHKRKPDITRAKELLGWEPKVPLREGLPLMVTDFRKRIF
GDQEA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagctcacgtaccgcggcggcgcgggggccccgggctccgcctccgacggc
ggggagtactcccccaagccctccaagccgctctcctggctcacccgcgccgcccgctac
gccgccgccgagcaccgccccgccttcgccctcgccgggatgctcctcgccgccgccctc
ttctccctctacgccccttcctccgacgcctcatcctccgccgccaccaccaccaccacc
accttcagccacctctcctcgctcccgtcgtcgtcggcggcgtcgctgcacgagtccgcc
ggggggaaggtgccgctgggcctccgccgccgcgcgctgcgggtgctcgtcacgggcggc
gccgggttcgtcgggagccacctcgtggaccgcctggtggagcgcggcgacagcgtgatc
gtcgtcgacaacttcttcacggggcgcaaggacaacgtggcgcaccacctcgccaacccg
cgattcgaggtgatccgccacgacgtcgtcgagcccatcctgctcgaggtcgaccagatc
taccacctcgcctgccccgctagccccgtgcactacaagtacaaccccatcaagaccatc
aagaccaacgtggttgggacactgaacatgcttggattggccaagaggattggggcaaaa
tttctcctcaccagcaccagtgaggtatatggagatcccctccagcaccctcaggtggag
acttactggggcaatgtcaaccccattggtgttagaagctgctatgatgagggcaagcgc
acagctgaaacgttgaccatggattaccaccgtggtgccaaccttgaggtgaggattgct
cggatttttaacacatatggtcctcgcatgtgcattgatgatggccgtgttgtcagcaac
tttgttgctcaggcactgaggaaggaacctttgactgtctatggtgatggcaagcagact
aggagctttcaatatgtctctgatttggtggaagggttgatgagcttgatggaaggggag
cacataggaccatttaacctgggtaatccgggtgagttcaccatgctggagctggctaag
gttgtccaggacaccattgatccgaatgctcgcattgagttccgtccgaacactgcggat
gatccacacaagcgcaagcctgacatcacccgtgcgaaagagctcctgggctgggagccc
aaggttcccctgcgtgagggccttcccctcatggttaccgacttccgcaaacgcatcttt
ggcgaccaggaagcctaa

DBGET integrated database retrieval system