KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0338000-01
Entry
Os01t0338000-01   CDS       T02163                                 
Symbol
Os01g0338000
Name
(RAP-DB) Similar to GTP-binding protein SAR1A.
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os01t0338000-01 (Os01g0338000)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os01t0338000-01 (Os01g0338000)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dosa04031]
    Os01t0338000-01 (Os01g0338000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-
     Os01t0338000-01 (Os01g0338000)
Membrane trafficking [BR:dosa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    Os01t0338000-01 (Os01g0338000)
GTP-binding proteins [BR:dosa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    Os01t0338000-01 (Os01g0338000)
SSDB
Motif
Pfam: Arf G-alpha Roc SRPRB MMR_HSR1 Ras PduV-EutP Gtr1_RagA
Other DBs
RAP-DB: Os01t0338000-01
Position
chr01:join(13286456..13286584,13286718..13286849,13287825..13288145)
AA seq 193 aa
MFLWDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELS
IGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDDSLA
AVPFLILGNKIDIPYAASEEELRYHLGLSNFTTGKGKVSLGESNVRPLEVFMCSVVRKMG
YGDGFKWVSQYIK
NT seq 582 nt   +upstreamnt  +downstreamnt
atgttcctgtgggactggttctacggcgtgctcgcgtcgctggggctgtggcagaaggag
gccaagatcctcttcctcggcctcgacaacgccggcaagaccaccctcctccacatgctc
aaggacgagaggttggtgcagcaccagccgacgcagcacccgacgtcggaggagctcagc
atcgggaagatcaagttcaaggccttcgatctcggcggccaccagatcgcccgccgcgtc
tggaaggactactacgccaaggttgatgctgtggtatatttggtagatgcttatgataag
gaacgttttgctgagtcaaaaaaggagcttgatgcactcctatctgatgattcattggca
gctgtcccgtttcttatccttggcaacaagattgacattccatatgctgcttctgaagag
gagctgcggtatcatctaggccttagcaacttcacaactgggaagggcaaggtcagccta
ggtgaatccaatgtccggcccctcgaagtgttcatgtgcagtgttgtccgcaagatgggc
tatggtgacgggttcaagtgggtctcccagtacatcaagtag

DBGET integrated database retrieval system