KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0367700-01Help
Entry
Os01t0367700-01   CDS       T02163                                 

Gene name
Os01g0367700
Definition
(RAP-DB) Similar to Cyclin-dependent protein kinase-like protein.
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dosa01001]
    Os01t0367700-01 (Os01g0367700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Os01t0367700-01 (Os01g0367700)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     Os01t0367700-01 (Os01g0367700)
Protein kinases [BR:dosa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Os01t0367700-01 (Os01g0367700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Seadorna_VP7
Motif
Other DBs
RAP-DB: Os01t0367700-01
Position
chr01:join(15059619..15059930,15060056..15060340,15060427..15060744,15063132..15063359,15064217..15064317,15065992..15066109,15066893..15067207)
AA seq 558 aa AA seqDB search
MGCVFGRPSSSPPAAAARKGRRKKRSSPMPAPSTDSPAADQSPGRGRPRRRLGRKPGPRQ
GCVPAPAAAEQLAAGWPPWLVAVAGEALRGWTPRRADTFEKLNKIGSGTYSNVYRARDTV
SGRIVALKKVRFDNLEPESVKFMAREILILRKLDHPNVIKLEGLVTSRMSCSLYLVFEYM
EHDLAGLAASPDVKFTLPQIKCYVQQLLSGLEHCHNNNVLHRDIKGSNLLLDNNGILKIA
DFGLATFFDPRHKRPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLHGKPIM
PGRTEVEQLHKIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCIREAFKDFPPSSLPLV
ETLLAIDPAERQTATSALQSEFFATEPYACDPSSLPTYPPSKEMDAKMRDEEARRLRAAA
KAKGEGVKRTRTRDRSQRAGPAPEANAELQANLDQRRRMITHANAKSKSEKFPPPHQDGA
MGNPLGSSRHMEPMYEHQDASFSTVVPIQKGSSQTWSGPLVDPAALGQSRRKKQTALDAK
AAAYSKQLQKDKGGTRAR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcgtcttcgggcgcccgtcgtcgtcgccaccggcggcggcggcgaggaagggg
aggaggaagaagaggtcgtccccgatgccggcaccctccacggactctcccgcggcggac
cagtccccggggaggggaaggccgcgccggaggctgggacgcaagccggggcccaggcag
gggtgcgtccccgcgccagcggccgcagagcagctcgccgcggggtggccgccgtggctc
gtcgccgtcgccggggaggccctccgcgggtggacgccccgccgcgccgacaccttcgag
aagctcaacaagatagggtcgggcacctatagcaacgtgtaccgcgcgagggacaccgtc
tccggccgcatcgtggcgctgaagaaggtccggttcgacaatctcgagcccgagagcgtc
aaattcatggccagggagatcctgatcctgaggaaactcgaccatcccaatgttatcaag
ctggaggggttggtcacgtcgaggatgtcatgcagcctgtacctggtgttcgagtatatg
gagcatgaccttgctggcctggcagcgagcccggacgtcaagtttactctgccgcagata
aaatgctatgtgcagcagctattgtcagggcttgagcattgccacaataataatgtattg
catcgggatatcaagggatcaaacttattgttggataacaatgggattcttaagatcgcc
gactttggcctggcaacattctttgacccacgacataaacgaccaatgacgagccgcgtg
gtcacgttgtggtaccggccacctgaattgttgttgggggcgacagactatggtgttggt
gtggatttgtggagtgccgggtgcattctggcagagctcttgcatgggaagcccatcatg
cctgggcgtactgaggtagaacagttgcacaagattttcaagctatgtggctccccctca
gaggagtattggaaaaagtccaagctgccacatgctacaatattcaaacctcagcagccc
tataagcgttgtatcagagaagcatttaaagattttcctccatcttccttgccgttggtt
gaaactctgcttgcaattgatccagctgagcgccaaactgctacatctgccttgcaaagt
gaattctttgcaactgagccttatgcatgtgatccatcaagcttgccgacatatccacca
agtaaggagatggatgctaagatgagagatgaggaagctagaaggctacgagcagctgca
aaggccaaaggagagggggtaaaaaggactcgaacgcgggatcgatctcaaagggcagga
ccagctccagaggctaatgcagagcttcaagcaaacctagatcagaggcgacgcatgata
acgcatgccaatgccaagagcaaaagtgagaagttccccccacctcatcaggatggagct
atgggtaacccattgggatccagtcgtcatatggagcctatgtatgagcaccaggatgct
tccttcagcacagtagtccccatccagaaggggtcctcacaaacatggtctggaccattg
gttgatccagcagctctagggcaatcgaggcggaagaagcaaactgccctagatgcgaag
gctgcagcttattcaaagcagctccagaaggacaagggcggaacaagagcacgataa

DBGET integrated database retrieval system