KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0369700-01
Entry
Os01t0369700-01   CDS       T02163                                 
Symbol
Os01g0369700, PHI_GLUTATHIONE_S-TRANSFERASE_5, GSTF5
Name
(RAP-DB) Similar to Glutathione S-transferase GST 8 (EC 2.5.1.18).
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00480  Glutathione metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Os01t0369700-01 (Os01g0369700)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dosa02000]
    Os01t0369700-01 (Os01g0369700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Os01t0369700-01 (Os01g0369700)
Transporters [BR:dosa02000]
 Other transporters
  Pores ion channels [TC:1]
   Os01t0369700-01 (Os01g0369700)
SSDB
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_5
Other DBs
RAP-DB: Os01t0369700-01
Position
chr01:complement(join(15171606..15171800,15171264..15171312,15170568..15171046))
AA seq 240 aa
MYQQSAGQIQLQEGPMAPMKVYGWVVSPWMARVLVALEEAGAEYEVVPMSRSGGDHRRPE
HLARNPFGEIPVLEDGDLTLYQSRAIARYIFRKYKPEFLGLGEGGSLEESAMVDVWLDVE
AHQHEAAVRPILWHCIINKFEGRDRDQGVVDESVRKLEKVLGVYEARLSGSRYLAGDRIS
LADLSHFSNMRYFMATEYAGVVDAYPHVKAWWEALLARPTVQKVMAGMPPDFGFGSGNIP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtaccaacaaagtgcagggcaaattcagctgcaagaaggaccaatggcgccgatgaaa
gtgtacgggtgggtggtatcgccatggatggcgcgggtgctggtggccctggaggaggcc
ggcgccgagtacgaggtcgttccgatgagcaggtccggcggcgaccaccgccggccggag
cacctcgccagaaacccgttcggtgagattccagtactggaggatggcgacctgacgctc
tatcaatcgcgagcaatcgctaggtacatctttcgcaagtacaaaccagagttcctggga
ctcggagaaggtggaagcctggaggagtcggcaatggtggacgtgtggctggacgtggaa
gcccaccagcacgaggccgccgtgaggcccatcctgtggcactgcatcatcaacaagttc
gagggccgcgaccgcgaccagggcgtcgtggacgagagcgtccggaagctggagaaggtg
ctcggggtgtacgaggcgaggctgtcgggctccaggtacctcgccggcgaccgcatcagc
ctcgcggacctcagccacttctccaacatgcgctacttcatggcgacggagtacgccggc
gtggtcgacgcgtacccgcacgtgaaggcgtggtgggaggcgctgctggccaggccgacg
gtgcagaaggtgatggccggcatgccaccggatttcggcttcggaagtgggaacatacca
tag

DBGET integrated database retrieval system