KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0530366-01
Entry
Os01t0530366-01   CDS       T02163                                 
Symbol
Os01g0530366
Name
(RAP-DB) RNA polymerase Rbp10 domain containing protein.
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    Os01t0530366-01 (Os01g0530366)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dosa03021]
    Os01t0530366-01 (Os01g0530366)
   03400 DNA repair and recombination proteins [BR:dosa03400]
    Os01t0530366-01 (Os01g0530366)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     Os01t0530366-01 (Os01g0530366)
  RNA polymerase III system
   RNA polymerase III
     Os01t0530366-01 (Os01g0530366)
  RNA polymerase I system
   RNA polymerase I
     Os01t0530366-01 (Os01g0530366)
DNA repair and recombination proteins [BR:dosa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      Os01t0530366-01 (Os01g0530366)
SSDB
Motif
Pfam: DNA_RNApol_7kD YjdM_Zn_Ribbon DUF5816 zinc_ribbon_13 zf-ribbon_3 OrfB_Zn_ribbon DZR HypA zinc_ribbon_2 PHD
Other DBs
RAP-DB: Os01t0530366-01
Position
chr01:join(19085992..19086034,19086461..19086553,19088032..19088054)
AA seq 52 aa
MDPQQPEPVSYLCGDCGAENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR
NT seq 159 nt   +upstreamnt  +downstreamnt
atggatccgcaacaacctgagcccgtcagctatctctgtggagattgcggagctgagaac
acactgaagccaggagatgtgatccagtgccgtgaatgtggctatcgcatcctctacaag
aagcgtacccgccggattgttcaatatgaagcacgctga

DBGET integrated database retrieval system