KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0565900-01
Entry
Os01t0565900-01   CDS       T02163                                 
Symbol
Os01g0565900
Name
(RAP-DB) Similar to Protein transport protein Sec61 beta subunit.
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03060  Protein export
dosa04141  Protein processing in endoplasmic reticulum
dosa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Os01t0565900-01 (Os01g0565900)
   04141 Protein processing in endoplasmic reticulum
    Os01t0565900-01 (Os01g0565900)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Os01t0565900-01 (Os01g0565900)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dosa02044]
    Os01t0565900-01 (Os01g0565900)
Secretion system [BR:dosa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   Os01t0565900-01 (Os01g0565900)
SSDB
Motif
Pfam: Sec61_beta
Other DBs
RAP-DB: Os01t0565900-01
Position
chr01:21632407..21632649
AA seq 80 aa
MVANGDAPARGSAAAAASLRRRRTTSSGTGGGGASTMLQFYTDEAAGRKMSPNSVLIMSI
GFIAVVALLHVFGKLYRTSA
NT seq 243 nt   +upstreamnt  +downstreamnt
atggtggccaatggagatgccccggctagagggagtgcagcagctgctgcaagcttgcgc
aggcgtagaaccaccagcagtggcactggtggaggcggtgccagcacaatgctccagttc
tacaccgatgaggctgctgggcgcaagatgtccccgaactcagtcctcatcatgagcatt
gggttcattgccgtcgttgctcttctgcatgttttcggcaagctttaccgcacctccgcc
tag

DBGET integrated database retrieval system