KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0571200-01
Entry
Os01t0571200-01   CDS       T02163                                 
Symbol
Os01g0571200
Name
(RAP-DB) Similar to Ribosomal protein L34.
  KO
K02914  large subunit ribosomal protein L34
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Os01t0571200-01 (Os01g0571200)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dosa03011]
    Os01t0571200-01 (Os01g0571200)
Ribosome [BR:dosa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Os01t0571200-01 (Os01g0571200)
  Bacteria
    Os01t0571200-01 (Os01g0571200)
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
RAP-DB: Os01t0571200-01
Position
chr01:join(21933336..21933603,21935292..21935391,21935645..21935717)
AA seq 146 aa
MSSAKTLARAGSSLLGRLLASPSPLRAGLPPPSLLSRIQPLVPPPPPPQPRPETTVEAYE
AQAVARLSSLPGEISFPCGLPSLRFIIEDGKDPVANEPLELLPKRTYQPSTIKRKRTHGF
LTRKSTKGGRKVIARRIAKGRHRISV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgtcgtcggcgaaaaccctagcgcgggcgggctcctccctcctcggccgcctcctcgcg
tccccgtctccccttcgcgcggggctgcctccgccgtcgctgctctccaggatccagccg
ctcgtccccccgccgccgccgccgcagccgcggccggagacgacggtggaggcctacgag
gcgcaggcggtggcgaggctgagctcgctcccaggagagatctccttcccctgcggcctc
ccctcgctccggttcatcatcgaagacggaaaggatcctgttgctaatgaacccctggag
ctacttccaaaaagaacttatcagcccagtaccatcaagcggaaaagaacccatgggttt
cttacacgaaaatcaaccaaaggtgggcgtaaggtgattgcgcgcaggattgccaagggc
aggcacagaatttcagtgtaa

DBGET integrated database retrieval system