KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0603000-01
Entry
Os01t0603000-01   CDS       T02163                                 
Symbol
Os01g0603000
Name
(RAP-DB) Similar to Nuclear RNA binding protein A.
  KO
K13199  plasminogen activator inhibitor 1 RNA-binding protein
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dosa03041]
    Os01t0603000-01 (Os01g0603000)
Spliceosome [BR:dosa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    Os01t0603000-01 (Os01g0603000)
SSDB
Motif
Pfam: HABP4_PAI-RBP1 Stm1_N API5
Other DBs
RAP-DB: Os01t0603000-01
Position
chr01:complement(join(23744582..23744744,23743614..23744025,23743366..23743510,23741486..23741644,23741349..23741405,23741067..23741267))
AA seq 378 aa
MGTKNQFDLLVDVDNDDPSHLIAAAEKKAAAAAASPKPAAQAKLPTKPPPPAQAVKESRN
YGAPAREGAGRNGPGRGSGGFGGGRIGQRRDFGEGDTNGVEGGYGASGFGDGIVRREEGE
HRPSERGHGPRQPYRGGGRRGGYTGGEAGDESGRAPHRAYERRSGTGRGYGMKREGAGRG
NWGTVTDEALAQESGEAVSIEVSVTVTEENKQEDVPQSDEVEKHKEGESNEEEEKEPEDK
EMTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKK
KENVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAA
PRIEDQAQFPGLAGRLVH
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggggacgaagaaccagttcgacctgctcgtcgacgtcgacaacgacgacccctcgcac
ctcatcgccgccgccgagaagaaggcggcggcggcggccgcgtcgcccaagccggccgcc
caggcaaagctgcccaccaagccgccgccgcccgcgcaggctgtaaaggagtccaggaac
tatggtgctccagcccgtgagggggcaggccgcaatggaccagggcgtggcagtggtggt
tttggtggaggcaggataggccaaaggcgtgattttggtgagggtgataccaacggtgta
gagggagggtatggcgctagcggctttggggatggaattgtgaggagggaagaaggtgaa
cacagaccttcagagaggggccatggaccacgccagccttaccgtggcggaggccgacgt
ggcggttacactggtggggaggctggggatgagtctggtcgtgctcctcaccgtgcctat
gaacgtcgtagtggcacaggtcgagggtatgggatgaaacgtgaaggcgcaggccgtggt
aactggggaactgtgactgatgaagcccttgcccaggaatctggtgaggctgtcagtatt
gaagtgtctgttaccgtgactgaggaaaacaagcaggaagatgtaccacaatctgatgaa
gtcgagaaacacaaggagggtgaatcaaatgaagaggaagaaaaggaacctgaagacaag
gagatgactttggaggaatatgagaaagtactggaggagaagaggaaagctttgctttca
ctgaaggttgaagagagaaaggttgtggtggacaaggaattgcagtcaatgcaacagctc
tcagtgaagaaggattctgatgaagtgttcatcaagctgggttctgacaaggacaaaaag
aaagaaaatgttgaaagagatgaacgcaccaggaagtctcttagcatcaatgaattcctg
aagccggctgaaggtgaaagatactacagcccaggtgggcgggggcggggacgtggcaga
ggacgtggtgaccgtggaggattccgggatggctatagctctcgaggtcctgttgccgca
ccaagaattgaagatcaagcgcagtttcccggcttggctgggagattggtgcactag

DBGET integrated database retrieval system