KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0626400-01
Entry
Os01t0626400-01   CDS       T02163                                 

Gene name
Os01g0626400, WRKY_GENE11, WRKY11
Definition
(RAP-DB) DNA-binding protein WRKY2-like (WRKY transcription factor 11) (WRKY16).
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: WRKY PBP1_TM
Other DBs
RAP-DB: Os01t0626400-01
Oryzabase: 6522
Position
chr01:join(25009546..25010075,25010996..25011139,25011303..25011768)
AA seq 379 aa
MSSGGGGGGGGDRHGPYHQHGHLGRGEGADYVYSSSDMESFFFSQPGGVGIGGGGGGVVG
AGGADEIMPYSSITDYLQGLLDPSGLARHLDVACPSSQDTVVKQELSVDVTSHDSQGTGG
VAGEGVAQATPNSSASFSSSDGEAEGGKSSRRCKKGQAKAEEEDDKDEEDGENSKKPNKP
KKKAEKRQRQPRVAFLTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKR
VERSYQDPSTVITTYEGQHTHHSPASLRGGGGGVGIVGGHHHHHLFMPGVHGLPPSHLMP
AGFHPELMGLMHHHPAMAAAAANPSMYFPGVAASAPPPPAVAGGGAMPPNDHPPLQQHHF
TDYALLQDLFPSTMPSSNP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtcttctggaggaggaggaggaggaggaggagatcgccatggcccctaccaccagcac
gggcacctcggccgcggcgaaggcgctgattacgtgtacagcagcagcgacatggagagc
ttcttcttcagccaacccgggggcgtcggcatcggcgggggtggtggtggcgtcgtcggc
gccggcggtgccgacgagatcatgccgtactccagcatcacggactacctgcaggggtta
ttggacccctccgggctagctcggcacctcgacgtggcgtgcccgtcgtctcaggacacg
gtggtcaagcaggagctgtcggtggatgtgacgagccacgacagccagggcaccggcggc
gtcgccggagaaggcgtcgcgcaggccacgccgaactcgtcggcgtccttctcgtccagc
gacggagaggcggagggcggcaaatcgtcacgccggtgcaagaagggtcaggcgaaggcg
gaggaggaggacgacaaggatgaggaggatggagagaactccaagaaaccgaacaagccc
aagaagaaagctgagaagaggcagcggcagcctcgcgtggcgttcctcaccaagagcgag
gttgatcacctcgaggacggctaccggtggcgcaagtacggccagaaggcagtcaagaac
agcccatacccgaggagctactaccggtgcacgacgcccaagtgcggtgtgaagaagcgg
gtggagcggtcgtaccaggacccctccacggtgatcaccacgtacgaagggcagcacacg
caccacagcccggcgagcctccgcggcggcggcggcggcgtcggcatcgtcggagggcac
caccaccaccacctcttcatgcccggcgtgcatggcctgccgccgtcgcacctcatgccg
gcggggttccaccctgagctgatgggcctcatgcaccaccacccggccatggccgccgcc
gccgcaaaccctagcatgtacttcccgggcgtagctgcttctgctccgccgcctcctgct
gtggctggcggcggtgcaatgccgcccaacgatcatcctcctcttcagcagcatcacttc
actgactacgccctgctgcaagaccttttcccttccacaatgcccagcagcaacccatga

DBGET integrated database retrieval system