KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0631900-00Help
Entry
Os01t0631900-00   CDS       T02163                                 

Gene name
Os01g0631900
Definition
(RAP-DB) Similar to aspartic proteinase oryzasin-1.
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dosa01002]
    Os01t0631900-00 (Os01g0631900)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     Os01t0631900-00 (Os01g0631900)
Peptidases [BR:dosa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   Os01t0631900-00 (Os01g0631900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N SapB_2 SapB_1 YopE_N TAXi_C
Motif
Other DBs
RAP-DB: Os01t0631900-00
Position
chr01:join(25291338..25291856,25291967..25292027,25292529..25292623,25292716..25292828,25293369..25293537,25293666..25293705,25293795..25293859,25294039..25294152,25294287..25294351,25294461..25294614,25294687..25294803,25296890..25296978,25297988..25298072)
AA seq 561 aa AA seqDB search
MGHTASRICTLLSILFVSCMLASAANDGLIRIALKKRPIMESIYGELVPKSGTVDHEVAL
GYSGVRMNSADEGFYDPVTEAINHVRVHQQRMLRDIEAAAMEGRLKHFWSYRGFRERGSL
KNGTQNHPLALKNFLNAQYFGEIGVGCPPQNFTVVFDTGSSNLWVPSAKCVFSLACYFHR
KYESRSSSTYMENGTPASIHYGTGSIHGYYSQDQVTIGDLVVNNQEFIEATHEPGLTFLA
AKFDGILGLGFKEISVEGADPVWYNMIQQSLVTDKVFSFWLNRNANDINGGEIVFGGADE
SHYKGDHTYTRVTRKAYWQFEMGDFLIGGRSTGICVDGCAVIADSGTSLIAGPIAAIAQI
HAHIGATGVANEECKQVVARHGHEMLELLQDKTPPAQVCSKIGLCKSDGAHGISDGIESV
LGETHKSADEVSDATCNACEMAVTWMQSEFVQNHTKEGKLEYANQLCGNMPSPVGSYVDC
RHIGHLPNVAFSIGGRAFELTPEQYILKFGEGFLAHCMSGFTALDIPPPIGPLWILGDVF
MGAYHTIFDYGKMRVGFADSA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacacagccagtcggatatgtacccttctctcgatcctcttcgtttcttgtatg
cttgcatctgctgccaatgatggactgatccgcatcgcgctgaagaagagaccgatcatg
gagagcatctacggtgaactagttcccaagagtggtacagtggaccacgaggttgcactt
gggtattctggcgtcaggatgaattcggcagatgagggattctacgatccggtcacggaa
gccattaaccatgttcgtgtgcatcagcaaagaatgctcagggacatagaggctgcagcc
atggaagggaggctcaagcatttctggagttacagagggttcagagaaaggggtagcctg
aaaaatggcactcagaatcatcctctagcgctgaagaactttctgaacgctcagtatttt
ggggagatcggagttggctgcccaccgcagaattttacggtggtctttgacaccgggagc
tccaacctctgggtcccttccgccaagtgcgttttttcgcttgcctgttacttccatcgg
aagtatgaatcaagaagttccagtacttacatggagaatggaacacctgcttccattcac
tatggaacaggatctattcatggttattacagtcaagatcaagttaccattggtgatcta
gttgtcaataatcaggaattcattgaagctactcatgagcctggtcttacgtttctagca
gcaaaatttgatggcatccttggacttggatttaaggaaatttcagttgaaggtgcagac
ccagtctggtacaatatgattcaacaaagccttgtgactgacaaggtattttccttttgg
ttaaatcgaaatgcaaacgatatcaatgggggtgagattgtgtttggaggtgctgacgag
agccattacaaaggtgatcatacatacacccgagttactcggaaagcttattggcagttt
gaaatgggagattttcttattggaggcaggagcactggaatttgtgttgacggttgtgct
gtcatagcagactcaggaacttcgttgattgctggtcctatagctgctattgcgcagatc
catgcacatattggagccaccggtgtggcaaacgaagagtgcaaacaagttgttgctaga
catgggcatgaaatgctagagttgctgcaagataagacaccaccagcacaagtgtgttcc
aaaattgggctctgcaaatccgatggagcgcatggaattagcgatggcattgagagtgtg
ctgggtgagacgcacaaatctgcagacgaagtttctgacgctacgtgtaatgcatgtgag
atggcagttacatggatgcagagcgaatttgttcagaaccatacaaaggagggcaagttg
gagtatgctaatcagctctgtggcaacatgcctagcccagtaggatcatatgtggactgc
agacacatcggtcacttgccgaacgtcgcattcagcataggtggaagagcatttgagctg
acaccggagcagtacattctcaaatttggagagggattcctggctcattgtatgagtgga
ttcacggctttagacattcctcctccaataggtcctctctggatattaggcgatgtgttt
atgggggcttatcacaccatctttgactatggcaaaatgagggttggatttgcagattca
gcgtga

DBGET integrated database retrieval system