KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0678500-01
Entry
Os01t0678500-01   CDS       T02163                                 

Gene name
Os01g0678500, TPC1, TWO-PORE_CHANNEL_1
Definition
(RAP-DB) Voltage-gated Ca2+ channel  protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade
  KO
K16900  two pore calcium channel protein, plant
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dosa04040]
    Os01t0678500-01 (Os01g0678500)
Ion channels [BR:dosa04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   Os01t0678500-01 (Os01g0678500)
SSDB
Motif
Pfam: Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 Tnp_22_dsRBD
Other DBs
RAP-DB: Os01t0678500-01
Oryzabase: 3069
Position
chr01:complement(join(27920592..27920807,27919310..27919453,27919096..27919203,27918575..27918670,27917946..27918055,27916703..27916763,27916059..27916225,27915866..27915971,27915665..27915742,27915181..27915242,27913969..27914041,27913049..27913114,27912555..27912698,27911866..27911923,27911096..27911203,27910448..27910511,27909876..27910044,27909457..27909521,27909226..27909316,27908686..27908772,27908415..27908486,27907813..27907853,27907647..27907734))
AA seq 757 aa
MRERGEMREAKAPLIAEAAEHISHSHGSGSSGTGSHTSGGGGGWRGSRQYQRRSDALAYG
NRYQKAAALVDLAEDGVGIPEDVLNDTRFERAMRFYFVYLRLDWLWSLNLFALILLNFLE
KPLWCRGYSQHACDQRDLYFLGQLPYLSKTESLIYEGLTLVILVMDIFYPLSYEGLNLFW
KNTINKLKVLLLFILACDILVFAFSPQPFRVAPYIRVAFLIMNIRELRMCAVTLVGMVGT
YLNVLALSLLFLLFASWLAYVTFEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAY
KSSRWSSLFFIVYVLLGVYFLTNLILAVIYDSFKEQLAKQVSQADCTRKSILEKAFGIID
ATGQGYLNKEQCLSLLDELNKYRSLPKTSREDFELIFAELDQSGDFKVTSEEFATLCNTI
AIKFQKEPPPSYLEKYPSFYHSALCEWLKSFVRSPLFEYIVIFVLLMNLVAVIIETTLDI
ENSSSQKVWQEVEFVFGWIYVIEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTF
AFPSKLSFLSNGEWIRYLLLGRMLRLTRILLQVRRFRAFVATFFTLMSSLMPYLGIVFCT
LCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQAW
MESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFAEMELEKDGEADIQDPTLE
GRNRRRSVRVRTKGTMVDILLHHMLSNELDGSQNRDQ
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgagggagaggggagagatgagggaggcgaaggcgcctctgatcgcggaggcggcggag
cacatatcccattcccacggctccgggtcgtccggcaccggcagccacaccagcggcggc
ggcggcgggtggaggggctcgaggcagtaccagcgccgctcggacgccctcgcctacggc
aaccggtaccagaaggcggccgccctcgtcgacctcgcagaagatggtgtgggtatccct
gaggatgtcttgaatgacacaaggtttgagagggctatgagattctattttgtgtatctc
cggttggattggctgtggtcacttaacctatttgctttgattcttttgaattttctcgag
aagcctctctggtgccggggatattctcaacatgcttgtgatcaaagggatctttacttt
ctggggcagttgccatacttgagcaaaactgaatctctcatatatgaggggctcacactt
gttattcttgtaatggatatcttctatccactgtcctatgaaggtttaaacctattctgg
aagaacacaataaataaactgaaggttcttcttctcttcatcttagcatgtgacatactg
gtgtttgcatttagtccccaacctttcagagtagctccttacatccgtgttgcgtttcta
ataatgaatatcagggaactgcgaatgtgtgctgttacactggttggtatggttgggaca
taccttaatgttttggccctttcactattgttcctcttattcgcaagctggctagcttat
gtaacatttgaggatacaccacaaggaaagactgttttctcgtcatatggtaccacgtta
tatcagatgtttattctcttcaccacctccaataatcctgatgtatgggttcctgcttat
aagagctctcgttggtcctcactattttttattgtctacgtacttttgggagtttacttc
ctaacaaatttaattcttgctgtcatttatgatagctttaaggagcagctagcaaagcaa
gtttctcaggcagactgtacaaggaaaagtatactagagaaggcatttggtatcattgat
gctactggtcagggttatctcaacaaagaacagtgcctatcattactagatgagctcaac
aaatacagatcgttacctaaaacctcaagggaagattttgaattaatttttgccgagctt
gatcagagtggtgattttaaggttacctctgaagaatttgctacactgtgcaataccatt
gcaataaaattccagaaagaaccacctccatcctatctcgagaagtatccatctttctat
cattcagcactgtgtgaatggttgaaatcttttgtgcggagcccactgtttgagtatatt
gttatttttgttcttctgatgaatctagtcgctgtcattattgaaacaacgctggatata
gaaaacagctcctcgcagaaagtgtggcaagaagttgagtttgtctttggatggatttac
gttatagagatggcactcaaaatattttcattaggatttggtgcctactggatggaaggt
caaaacaagtttgattttgtgcttacttggactatatttattggagagactctaacattt
gccttcccatcgaagctttcttttctttcaaatggagaatggattcggtaccttcttctt
ggaaggatgttacgcttgacaagaattctgttgcaagttcggcgtttcagagcatttgtt
gcaacattctttactctgatgtctagcttgatgccatatttggggattgtattctgcacc
ctttgcatttactgctcccttggtttgcagatatttgggggcattgtgtatgcaggaaat
ccaacactagaagaaaccgatctcttcagtaacgactatcttctttttaacttcaatgac
tatccaagtggtatggtaactctgttcaatttgttagtgatgggcaattggcaagcttgg
atggagagctacaggcaattgactggaagttattggagcctgatttattttgtcagcttt
tacctcatttcagtattactgctgcttaatctgattgtagcatttgtgttggaggcattt
tttgctgagatggaactggagaaagatggcgaagctgatatccaggatcctactttggaa
ggaagaaacaggcggcgatctgtgcgtgtgaggacaaaggggaccatggttgatattctt
cttcaccatatgttgagcaatgaacttgatggatctcaaaaccgtgaccaatag

DBGET integrated database retrieval system