KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0751600-01
Entry
Os01t0751600-01   CDS       T02163                                 

Gene name
Os01g0751600
Definition
(RAP-DB) Similar to triacylglycerol lipase.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: Lipase_3 Thioesterase Hydrolase_4 Abhydrolase_6 Abhydrolase_3
Other DBs
RAP-DB: Os01t0751600-01
Position
chr01:complement(join(31526741..31526967,31524334..31525342))
AA seq 411 aa
MAIDLAPLAGELEVAGAAVGGKKEEGEGEEGGVCGGEAVVVAAADAEVEGHPYDFHVSGP
RNLPPPNWREIIRSSWKDPNYKRMVMACFIQAVYLLELDRQDEKGEEDGLAPKWWKPFKY
KVTQTLVDERDGSIYGAVLEWDRSSALSDLILIRPSGAPRAVLALRGTLLQKPTIKRDLQ
DDLRFLVWESLKGSVRYIGALEALKTAVERFGSANVSVAGHSLGAGFALQVCKELAKQGV
FVECHLFNPPSVSLAMGVRSMSEKASYLWKKVKASLPLTEEALPDSTKEEGSAKKKLRAD
KKWVPHLYVNNSDYICCHYNAPNCSTTTTTTTTDGASDEQQQQRKASEIAGDVVAKLFVT
SKGPQKFLEAHGLEQWWSDGMELQLAVYDSKLIYRQLKSLYTATAPSPPAK
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcgatcgacctggcgccgctggctggggagttggaggtcgcgggggcggcggttgga
gggaagaaagaggagggggagggggaggagggcggggtgtgcggcggggaggccgtggtg
gtggccgcggcggacgcggaggtggagggccacccctacgacttccacgtgtccgggccg
cggaacctgccgccgcccaactggagggagatcatccgttcgagctggaaggatcccaat
tacaaaaggatggtaatggcctgcttcattcaagcagtctacctgcttgaactggacagg
caagatgagaaaggagaagaggatggccttgctccaaaatggtggaagcccttcaaatac
aaggtcacacagacattggtcgatgagagagatggttccatctatggtgccgtccttgag
tgggatcgttcttctgctttgtctgaccttatcctcataagaccaagtggcgcgccaagg
gctgtgttagctctccgaggaacactgcttcagaagcccaccatcaagagagacctacaa
gatgatcttcgcttcctggtgtgggagagcttaaaaggatcagtcagatatattggcgct
ttagaagcactgaagacagcagttgagaggtttggtagcgctaatgtcagtgttgctggg
cactccttgggagctggatttgctcttcaggtttgcaaagagctcgctaagcaaggagtc
ttcgtggagtgtcatctgttcaatccaccttctgtttcacttgccatgggtgtaaggagt
atgagtgagaaggccagctacctgtggaaaaaagttaaggctagtctaccactgactgaa
gaagcattacctgacagtaccaaagaggagggaagtgcaaagaagaaattgcgtgctgac
aagaaatgggtgccacatttatatgtaaacaacagtgactacatctgctgtcactacaat
gcccctaattgctccaccaccaccaccactaccaccactgatggtgcttcagatgagcag
cagcagcaacgaaaggcaagtgagatcgctggtgatgtggtcgcgaagctttttgtgaca
tcgaaaggcccacagaagtttcttgaagcgcatgggctggagcaatggtggtcggatggc
atggagctgcagctagcagtgtatgacagcaagcttatatacaggcagttgaagtccctc
tacacagcaactgcaccgtcaccccctgcaaagtag

DBGET integrated database retrieval system