KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0824500-00
Entry
Os01t0824500-00   CDS       T02163                                 

Gene name
Os01g0824500
Definition
(RAP-DB) Hypothetical conserved gene.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: EPF
Other DBs
RAP-DB: Os01t0824500-00
Position
chr01:join(35224856..35225065,35225864..35226067)
AA seq 137 aa
MASSGGRWRRSGSSMLKLVVALCFFAVAISLCCVCLSSGCGGSGCGGFRRRAVLLRLGNE
IQRAASFCALDHSSSGRRWRRLLAEGPGSYPPRCTAKCGACVPCYPVHVAVPPGVPVTTE
YYPEAWRCKCGNRLYMP
NT seq 414 nt   +upstreamnt  +downstreamnt
atggcgagctcgggggggaggtggaggcggagcggcagttccatgctaaagctggtggtg
gccttgtgcttcttcgctgtggccatctccctgtgttgcgtctgcctcagctcgggttgc
ggtggcagtggctgtggtggattcaggcggcgcgctgtgctgctccgtttaggtaatgaa
attcagcgagctgcatccttctgcgcacttgatcacagctcgagcgggcgtcgatggcgg
cggctgctggcggagggcccggggtcgtacccgccgcggtgcacggccaagtgcggcgcc
tgcgtcccgtgctacccggtgcacgtcgccgtgccgcccggcgtcccggtcaccaccgag
tactacccggaggcgtggcggtgcaagtgcggcaaccggctctacatgccatga

DBGET integrated database retrieval system