KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0834400-01
Entry
Os01t0834400-01   CDS       T02163                                 

Gene name
Os01g0834400, HAP3A_SUBUNIT_OF_CCAAT-BOX_BINDING_COMPLEX, HAP3A
Definition
(RAP-DB) Similar to HAP3.
  KO
K08065  nuclear transcription Y subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os01t0834400-01 (Os01g0834400)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os01t0834400-01 (Os01g0834400)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP TFIID-18kDa TFIID_20kDa
Other DBs
RAP-DB: Os01t0834400-01
Oryzabase: 3123
Position
chr01:complement(join(35758558..35758558,35758251..35758470,35757998..35758129,35757421..35757424))
AA seq 118 aa
GFLEGGAGMADAGHDESGSPPRSGGVREQDRFLPIANISRIMKKAVPANGKIAKDAKETL
QECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREV
NT seq 357 nt   +upstreamnt  +downstreamnt
gggtttttggagggcggcgcggggatggcggacgcggggcacgacgagagcgggagcccg
ccgaggagcggcggggtgagggagcaggacaggttcctgcccatcgccaacatcagccgc
atcatgaagaaggccgtcccggcgaacggcaagatcgccaaggacgccaaggagaccctg
caggagtgcgtctcggagttcatctccttcgtcaccagcgaggcgagcgacaaatgtcag
aaggagaagcgcaagaccatcaacggggaagatctcctctttgcgatgggtacgcttggc
tttgaggagtacgttgatccgttgaagatctatttacacaagtacagagaggtgtag

DBGET integrated database retrieval system