(EC: No such database in dbtab.

KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0883800-01
Entry
Os01t0883800-01   CDS       T02163                                 

Gene name
Os01g0883800
Definition
(RAP-DB) Similar to GA C20oxidase2.
  KO
K05282  gibberellin-44 dioxygenase [EC:1.14.11.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00904  Diterpenoid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00928  Gibberellin A4/A1 biosynthesis, GA12 => GA4 / GA53 => GA1
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    Os01t0883800-01 (Os01g0883800)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.12  gibberellin-44 dioxygenase
     Os01t0883800-01 (Os01g0883800)
SSDB
Motif
Pfam: 2OG-FeII_Oxy
Other DBs
RAP-DB: Os01t0883800-01
Position
chr01:join(38382387..38382758,38383141..38383446,38384918..38385208)
AA seq 322 aa
HTHTLTLTHALNSLPLNTALTSHLQSHGGRAPHATTAAPTTAHGLHRRLWHCRPGGGGGV
RPEDGAQDPGAIRVAERRREAGVGGGAGHARGRRGRAPRRRRRGAAPRRGAGGRRVRHAR
VLPGYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEPERTLGTG
PHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRYKSCLHRA
VVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRADTRTLDA
FTRWLAPPAADAAATAQVEAAS
NT seq 969 nt   +upstreamnt  +downstreamnt
cacacacacacactcacactcacacacgctctcaactcactcccgctcaacacagcgctc
acttctcatctccaatctcatggtggccgagcaccccacgccaccacagccgcaccaacc
accgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtg
cgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgag
gccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacgg
cgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgg
gttcttccaggttactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctg
gagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctca
atcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggc
ccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgag
gtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaac
atcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcg
gtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggac
agggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgg
gccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgcc
ttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcg
gccagctga

DBGET integrated database retrieval system