KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0885000-01Help
Entry
Os01t0885000-01   CDS       T02163                                 

Gene name
Os01g0885000
Definition
(RAP-DB) Similar to Cytochrome c.
  KO
K08738  cytochrome c
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
RAP-DB: Os01t0885000-01
Position
chr01:join(38443699..38443810,38444908..38445041,38446043..38446132)
AA seq 111 aa AA seqDB search
MATFSDAPPGDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSG
DKIVPVIWEENTLYDYLLTPKKYTPAKMGFNGLKQPQDRADLIAYLKNATA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattctccgatgcgccgcccggggacgcggcggccggcgagaagatcttcagg
accaagtgcgcgtactgccatgccgtcgacaaggccgccggccacaagcatgggccaaac
ttgaacggtttgtttgggaggcaatctggtacagctcctggtttctcttacccatctggc
gacaagatagtgcctgtgatttgggaagagaacactttgtatgactacctgcttactcct
aagaagtacactcctgccaagatggggttcaatggactgaagcagccacaggaccgtgct
gatctcatcgcatacctgaagaacgccacagcatga

DBGET integrated database retrieval system