KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0897600-01Help
Entry
Os01t0897600-01   CDS       T02163                                 

Gene name
Os01g0897600
Definition
(RAP-DB) Glycoside hydrolase, family 1 protein.
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00460  Cyanoamino acid metabolism
dosa00500  Starch and sucrose metabolism
dosa00940  Phenylpropanoid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os01t0897600-01 (Os01g0897600)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Os01t0897600-01 (Os01g0897600)
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    Os01t0897600-01 (Os01g0897600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Os01t0897600-01 (Os01g0897600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
RAP-DB: Os01t0897600-01
Position
chr01:join(39005089..39005175,39005975..39006041,39006118..39006176,39006377..39006452,39006597..39006671,39006748..39006835,39007002..39007227,39007430..39007545,39007913..39008124,39008623..39008657,39008746..39008848,39009386..39009494,39009579..39009777)
AA seq 483 aa AA seqDB search
MGSTGRDAEVTRGDFPDGFVFGVATSAYQIEGARREGGKGDNIWDVFTENKERILDGSSG
EVAVDHYHRYKEDIELMASLGFRAYRFSISWPRIFPDGLGKNVNEQGVAFYNDLINFMIE
KGIEPYATLYHWDLPHNLQQTVGGWLSDKIVEYFALYAEACFANFGDRVKHWITINEPLQ
TAVNGYGIGHFAPGGCEGETARCYLAAHYQILAHAAAVDVYRRKFKAVQGGEVGLVVDCE
WAEPFSEKTEDQVAAERRLDFQLGWYLDPIYFGDYPESMRQRLGDDLPTFSEKDKEFIRN
KIDFVGINHYTSRFIAHHQDPEDIYFYRVQQVERIEKWNTGEKIGERAASEWLFIVPWGL
RKLLNYAAKRYGNPVIYVTENGMDEEDDQSATLDQVLNDTTRVGYFKGYLASVAQAIKDG
ADVRGYFAWSFLDNFEWAMGYTKRFGIVYVDYKNGLSRHPKASARWFSRFLKGDDAENKA
DMN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggggagcacggggcgcgacgcggaggtgacccgcggcgacttccccgacggcttcgtc
ttcggcgtcgccacctccgcttaccagattgaaggggcgagacgggagggaggcaaagga
gataacatatgggatgttttcacagaaaacaaagaacgtatcttagatgggagcagtgga
gaagttgcagttgatcattaccatcgatacaaggaagacattgaactcatggccagtttg
ggtttccgtgcttatagattttctatatcttggccacgcatatttcctgatggcctgggg
aaaaatgtcaatgagcaaggagttgccttttataatgaccttataaatttcatgattgag
aaaggtattgagccatacgcaactctgtatcattgggatcttccacataatcttcagcag
actgtgggtggttggctttctgataagatcgtggagtactttgcactgtatgcagaagct
tgctttgcaaattttggagacagagtaaagcattggataacaatcaatgagcctcttcaa
actgcagttaatggttacggaattggacattttgcacctggaggatgtgaaggggaaact
gctagatgctacttggccgcccactaccaaatcttggctcatgctgctgctgttgatgtt
tacagaaggaaatttaaggctgtgcaaggtggtgaagtaggcttggttgtcgattgtgaa
tgggcagagccattttcagagaaaacagaagatcaggttgctgcagaacgaaggcttgac
tttcagctaggatggtacctggacccaatatatttcggtgattacccagaaagtatgcgt
cagcgactgggcgatgatcttccaaccttctcggagaaagataaagaatttatcaggaac
aaaattgactttgttggaataaatcattatacttcaagattcattgctcatcatcaggat
ccagaagatatttatttttaccgagtacaacaagtggagagaatagaaaaatggaacact
ggtgaaaaaattggtgaaagggccgcatctgagtggcttttcatagttccttggggcctc
cggaaattacttaattatgcagcaaagagatatggaaatcctgtgatatatgtaactgag
aatggcatggatgaggaagatgatcaatcggcaacgcttgaccaagtcttgaatgatacg
acgagggttggttacttcaaaggatacctcgcgtcagttgcacaagcaatcaaggatggt
gctgatgttcgtgggtacttcgcatggtcgttcctggacaacttcgagtgggctatggga
tacaccaagaggtttggcattgtttatgttgattacaaaaatgggctttcccggcatccc
aaagcatcggcccggtggttctcgcgcttcttaaagggcgatgacgctgagaacaaagct
gacatgaactag

DBGET integrated database retrieval system