KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0914800-01
Entry
Os01t0914800-01   CDS       T02163                                 

Gene name
Os01g0914800
Definition
(RAP-DB) Protein of unknown function DUF231, plant domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: PC-Esterase PMR5N
Other DBs
RAP-DB: Os01t0914800-01
Position
chr01:join(39858263..39858695,39858851..39859128,39860087..39860884)
AA seq 502 aa
MSPPGRKAPAGAGGIRRWLSTVVVSVVALVLTLVVISLSVGSSLTGASLHEYLFVRPSDS
SKLTDGNMNGTAVGVPLQEEVLQGGKEVPVEHGVQSGGVNSSETGEIDTKVQDPVVTDDT
ASVPDERNLPVSSDSSDNLQKTNEGSCDLYHGHWVFDSSGPLYTNNSCPIITQMQNCQGN
GRPDKDYENYRWKPEQCILPRFDGPKFLELMRGKTIAFVGDSVARNQMESLLCILWQVEA
PVNRGSRRMSKWIFRSTSTIIVRIWSSWLVHRSTEAVGFAPKGIDKVFLDIPDETFMEFI
PRFDVLVLSSGHWFAKRSAYILNGNVVGGQLWWPRKAGNMQINNVDAFGISVETCLTALA
TNPNFTGIAIVRTYSPDHYEGGAWNTGGSCTGKTKPLDVVVRNGFTDTMYGKQVSGFTKA
VQNSGKHGSRLKLMDITEPFALRPDGHPGPYRSTDPNKKTQRGPDGRPPPQDCLHWCMPG
PVDTWNEMLLETIRREFEGVRS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgagtccgccggggaggaaggccccggccggtgcgggcgggatccgtcggtggctctcc
accgtcgtcgtgtcggtggtggctcttgtgctaaccctagtagtgatatcgctatcggtg
ggctcgtctctgaccggggcatcgctacacgagtacctctttgtcagacctagtgattca
tccaagcttactgatgggaacatgaatggtactgccgttggtgttccattacaagaggaa
gtgttgcagggtggcaaggaagtacccgtggagcacggtgttcagagtggcggcgtgaat
tcgagcgagacgggtgaaatcgataccaaagtacaagatccagttgttaccgatgatacc
gcgtcagtgcctgatgagagaaatctccctgtctcatcggattcatccgacaatcttcag
aagactaatgaaggtagctgtgatctataccatggacattgggtttttgattcttctgga
ccactatacacaaacaactcttgcccgatcatcacgcagatgcagaattgtcaaggaaat
ggtcgacctgataaggattatgaaaattatagatggaaaccagaacagtgcatcctacca
cgctttgatggaccaaagttcctggagttgatgagaggcaagacaattgcatttgttggt
gattcagttgccagaaatcagatggaatccctcctctgcattctgtggcaggtagaggcc
ccagtaaaccgtggtagccgcaggatgagcaagtggatttttaggtcaacctcaacaatt
atcgtccgcatctggtcgtcttggttagtgcacaggtcaactgaagctgtggggtttgct
cctaagggtatcgataaggttttcctggatatcccggatgagacctttatggaatttatc
ccacgttttgatgtgcttgtcctctcctctgggcactggtttgccaaacggtctgcttat
atcctgaatggcaatgttgttggagggcagctctggtggcctcgtaaagctggaaatatg
cagatcaacaatgttgatgcttttggtatatctgttgagacatgcctaactgctctagct
accaatccaaatttcacaggtatagctatcgtgcgcacatattcaccagatcattatgaa
ggtggggcttggaataccggtggatcatgcactggaaagactaagcccttggatgtggtg
gtgaggaatggattcacggacaccatgtatggaaagcaggtttcagggttcacaaaagca
gtgcagaattctgggaaacatggttccaggttgaaattgatggacatcactgagcccttt
gccctgaggcctgatgggcatcctggtccatatagaagtactgacccaaacaagaagacg
caaagaggtccagatggaaggcctccacctcaggattgcctacattggtgcatgccagga
cctgtagatacatggaatgagatgttgctagagaccatacgaagagagttcgagggagtg
agaagctga

DBGET integrated database retrieval system